KEGG   Peptoclostridium difficile BI1: CDBI1_03545Help
Entry
CDBI1_03545       CDS       T01779                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
cdg  Peptoclostridium difficile BI1
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cdg00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    CDBI1_03545
Enzymes [BR:cdg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     CDBI1_03545
Exosome [BR:cdg04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CDBI1_03545
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
839945..841471
Genome map
AA seq 508 aa AA seqDB search
MKYVLAIDQGTTGTRAVLINEKSEFVFSDYMEHTQIYPQSGYVEHDPIEIWNNTKTVSNN
VLQQAFESGINESDIKGIGIDNQGETVMLWDKNTGKPLYNAIVWQCRRTYDYVENLKNIP
GLENKIIDKTGLIIDPYFSGTKIKWVIDNVKGVKEKIKNGEVLAGTLDSWLIWKMTGGKS
FLTDVSTAARTMLFNIRDMDWDRELLDIIGVPRSILADIMPTSGDFGTTDKEAFCGVSIK
ITASMVDQPAALFGNGCFEPGMVKNTYGTGCFLYMNIGEELNIAGNGILTTVAWKIGDKV
TYAYDGGVYIAGAAIQWLRDGIGVIKNYSETDDMANSISSTGGVYFVPAFAGIAAPYWDQ
YARGTMVGITGSTKKEHIVRATLESVALQVKDVVDSMNLASGKEIKMLRVDGGITKNNFT
MQFQSDILDIPIEIAENPETTVLGVGYMAGLSCGVWNSIDEIRSEFTISKKYIPNMTKQK
REEILLGWNQAVKRAMNWENDTKKVCAN
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
gtgaaatatgtattagcaattgaccaaggaacaacaggaacaagagcagtattgataaac
gaaaaatcagagtttgtttttagcgattatatggaacatactcaaatatatccacaatct
ggatatgttgaacatgaccctatagaaatttggaataatacaaaaactgtgagtaataat
gtattacaacaggcttttgaaagtggaatcaatgaaagtgatataaaaggaattggtata
gataatcaaggtgaaacagtaatgttatgggataaaaatacaggtaaaccactttacaat
gctatcgtatggcagtgtaggagaacttatgattatgtggaaaatttaaagaatatacca
ggtttagaaaataagataatagataagactgggttaattatagacccatatttctcaggt
acaaaaattaaatgggtaatagataatgtaaaaggtgtaaaagaaaaaattaaaaatgga
gaagtacttgcaggaacattggatagttggttaatatggaaaatgacaggaggaaaatct
tttttaactgatgtatctacagcagcaagaacaatgctttttaatataagagatatggat
tgggatagagagttgcttgacattataggagtgcctagaagtattttagcagatataatg
cctactagtggtgattttggaactacagataaggaggcattttgtggggtttctataaaa
attactgcttcaatggtagaccaaccagcagctttatttggcaatggatgttttgaacca
ggaatggttaaaaatacttatggtacaggatgtttcttatatatgaatataggtgaggag
ttaaatatagcaggtaatggtattttgacaacagttgcttggaagataggagataaagtt
acatatgcttatgatggtggagtgtatatagcaggtgctgcaatacaatggcttagagat
ggaattggagttataaaaaattattcagaaactgatgacatggcaaattccatatcaagt
actggaggggtatattttgtaccagcatttgcaggtatagcagcaccttattgggaccaa
tatgctagaggcacaatggttgggataacaggaagtactaaaaaagaacatatagtaagg
gctactcttgagtctgttgcacttcaagtcaaggatgttgttgattccatgaatttggct
tcagggaaagaaataaaaatgttgagagtagatggtggaattactaaaaataactttaca
atgcaatttcaatctgacatattagatataccaattgaaattgcagaaaatcctgaaacg
acagtacttggtgtagggtatatggcagggctttcctgtggtgtttggaacagtattgat
gaaattagaagtgaatttacaataagcaaaaaatatattccaaatatgactaagcaaaaa
agagaagaaatattacttggatggaatcaagcagtaaaaagagctatgaattgggaaaac
gataccaaaaaggtgtgtgctaattaa

DBGET integrated database retrieval system