KEGG   Clostridium difficile BI1: CDBI1_04310Help
Entry
CDBI1_04310       CDS       T01779                                 

Definition
agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
cdg  Clostridium difficile BI1
Pathway
Arginine and proline metabolism
Metabolic pathways
Module
Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:cdg00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Structure
PDB: 

Jmol
Position
1012413..1013291
Genome map
AA seq 292 aa AA seqDB search
MKNNFYHMNTFMSMDKNYEESNLIVFGVGFDGTTSNRPGARFASSSMRKEFYGLETYSPF
LDLDLEDYNICDYGDLEISVGSTEQVLKEIYQETYKIVRDSKVPFMIGGEHLVTLPAFKA
VHEKYNDIYVIHFDAHTDLREEYNNSKNSHATVIKRIWDIVGDNKIFQFGIRSGTKEEFK
FATEEKHTYMEIGGIDTFENIVNMLNGKNIYLTIDLDVLDASVFPGTGTPEPGGVNYREF
QEIFKIIKNSNINIVGCDIVELSPDYDTTGVSTVIACKILRELCLIISDKIK
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgaagaataatttctatcatatgaacacttttatgagtatggacaaaaattatgaagaa
tctaatcttatagtatttggtgttggatttgatggaactacttctaacagacctggggct
agatttgcaagtagctctatgagaaaagaattttacggtcttgagacatatagtcctttt
ttagatttggacttagaggattataatatatgtgattatggagatttagaaattagtgtt
ggaagtacagaacaagtcttaaaagaaatctatcaagagacatataagattgttagagat
tcaaaggtaccctttatgattggaggagagcatttagttacattaccagcctttaaagca
gtacatgaaaagtacaatgatatatatgtaattcattttgatgcccatactgatttgagg
gaagaatataataatagtaaaaattctcatgcaacagtaattaaaagaatatgggatatt
gtaggtgataataaaatatttcaatttggtataaggtctgggacaaaagaagaatttaaa
tttgctacagaagaaaaacacacatacatggaaataggaggaatagatacgtttgaaaat
atagttaatatgctaaatggaaagaatatttatctaactatagatttagatgtattggat
gcatctgtgtttccgggaacaggtacaccagaacctggtggtgtaaattatagagagttt
caagagatttttaagattataaaaaactctaatataaatatagttggttgtgatattgta
gagttaagccctgattacgatacaacaggtgtatcgacagttatagcttgtaaaatctta
agagagttatgcttaataatatctgataaaattaaatag

DBGET integrated database retrieval system