KEGG   Peptoclostridium difficile BI1: CDBI1_05365Help
Entry
CDBI1_05365       CDS       T01779                                 

Definition
fructose-1,6-bisphosphatase
Orthology
K04041  
fructose-1,6-bisphosphatase III [EC:3.1.3.11]
Organism
cdg  Peptoclostridium difficile BI1
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cdg00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CDBI1_05365
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CDBI1_05365
   00030 Pentose phosphate pathway
    CDBI1_05365
   00051 Fructose and mannose metabolism
    CDBI1_05365
  Energy metabolism
   00680 Methane metabolism
    CDBI1_05365
Enzymes [BR:cdg01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     CDBI1_05365
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1260006..1261991
Genome map
AA seq 661 aa AA seqDB search
MKNLCKISDDYLNSKLKYLKLLSKQYPSISKASTEIINLEAILNLPKGTEHFITDVHGEY
EPFVHVLKNGSGVIKRKIEELFSNTIRDSEKKMLATLVYYPEQKLDLIIKQEENIDDFYR
INIYRLIELCKYASSKYTRSKVRKLLPENFKYIIEELLHEHVKSEHKEEYYKSIVETIVD
IGIAKEFIIAISTVIQKLVVDRLHVIGDIYDRGPRPDIIVDKLIEHHCVDIQWGNHDILW
MGAASGEKTCIANALRISARYANLDIVEDIYGINLLPLATFAIEMYKDDPCKEFIPKVND
QSVTTTEKSLMAKMHKAISIIQFKLEGEVIRRRPEFEMEHRLLLNMINYDEGTITLKGKT
YKLKDTYLPTIDKKDPYKLTMEERNVIDKLVSSFRGSEKLQKHVSFLFSKGSIYLKANSN
LLIHGCVPLNEDGSFMSMNIMGKEYKGKALMDKMESLAREGFFFKDKAEEKLYGMDIMWY
LWTGKCSSLFGKDDMTTFERYFIEEKETHKENKNPYFKLRENEMACKRLFEEFDLELDES
HIINGHVPVESKNGESPIKANGKILVIDGGFSRAYQKTTGIAGYTLIYNSRTLQLVSHEP
FNSAEEAIANESDILSTTVVVEHKAKRKMVRDTDEGVKIQEEIEDLKLLLMAYKKGLIKE
M
NT seq 1986 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatctgtgtaaaatatcagatgattatttaaacagcaagcttaagtatttaaag
ttattatcaaaacaatatccaagtatatcaaaagcaagtacagaaataataaatttagag
gctatattaaatcttccaaagggaacagagcattttataacagatgtacatggtgaatat
gaaccatttgtacatgtattaaaaaatggttctggtgtaataaagagaaaaatagaagaa
ttgttttcaaatacaataagagacagcgaaaaaaaaatgttagcaactcttgtatattat
cctgaacaaaagttagacctaataattaagcaagaggaaaatatagatgatttttataga
ataaatatttatagacttatagaactttgtaaatatgcttctagcaaatatactaggtct
aaagttagaaaactgttaccagaaaattttaaatacataatagaagaacttttgcatgag
catgttaaaagtgaacataaagaagagtattataaaagtatagttgaaacaatagttgac
ataggaatagctaaggagtttataattgctatttctacagttatacaaaaattggttgta
gatagacttcatgtaataggagatatttatgatagaggtccaagaccagatataattgtc
gataagcttattgaacatcattgtgtggatattcaatggggaaatcatgatatattgtgg
atgggtgcagcctcaggtgaaaaaacttgtatagcaaatgcactgaggatatcagctaga
tatgcgaatttagacattgtagaagacatatatggaataaatctgttgcctttagccact
tttgctatagaaatgtataaagatgacccttgtaaagaatttattccaaaggttaatgac
caaagtgtaacaacaacagaaaagtctttaatggcaaaaatgcacaaagcaataagtata
attcaatttaagcttgaaggtgaggttataagacgaagacctgaatttgaaatggaacat
agacttttgcttaatatgataaactatgatgaaggtacgattactttaaaaggtaaaaca
tataaattaaaagatacttatttacctacaatagacaaaaaagacccatataaattaact
atggaagaaagaaatgttattgataaattagtatcttcatttagaggtagtgaaaaatta
caaaaacatgtttcatttttgttttctaaaggaagtatatatttaaaggctaactcaaat
ttactgattcatggatgtgtaccattaaatgaagatggaagctttatgtctatgaatata
atgggaaaagagtataaaggtaaggctcttatggataagatggagtctctagcaagagaa
ggatttttctttaaagataaggcagaagaaaaactatatggtatggatattatgtggtat
ttatggactgggaaatgttcatcattatttggtaaagatgatatgactacatttgaaaga
tactttatagaagaaaaagagactcataaagaaaataagaatccatattttaaacttaga
gaaaatgagatggcttgtaaaagattatttgaagaatttgatttagagcttgatgaatcc
catataataaatggtcatgttcctgtggagagtaaaaatggagagagcccaataaaagct
aatggtaaaattctcgttatagatggtggtttttctagggcttaccaaaaaactactggt
atagctggatacactttgatatacaattctagaactttgcaattagtatcgcatgaacca
tttaattctgctgaagaagccattgcaaatgaaagtgatatcttatcgacaactgttgta
gtagagcataaggcaaagagaaaaatggtgagagatactgatgaaggagtaaaaatacaa
gaggaaatagaagatttaaaactacttttaatggcttataagaaagggctaataaaagaa
atgtag

DBGET integrated database retrieval system