KEGG   Peptoclostridium difficile BI1: CDBI1_06385Help
Entry
CDBI1_06385       CDS       T01779                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
cdg  Peptoclostridium difficile BI1
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cdg00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    CDBI1_06385
Enzymes [BR:cdg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     CDBI1_06385
Exosome [BR:cdg04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CDBI1_06385
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1468260..1469774
Genome map
AA seq 504 aa AA seqDB search
MEKKYVMALDQGTTSSRAILFNKKGEIVKIAQKEFNQIYPKAGWVEHDPMEIWGSQSGVM
REVIETAGIRPEEIASIGITNQRETTVVWSRYTGKPIYNAIVWQCRRTSEICDELKNKGL
EESIKEKTGLLIDAYFSATKVKWILDNVEGAREKAEQGELLFGTIDTWLIWNLTRGKVHV
TDYSNASRTMMYNINDLEWDEDILRELDIPISMLPLVKPSSYVYGHTDERMLSGAKIPIA
GCAGDQQAALFGQNCVEEGTAKNTYGTGCFLLMNTGSNIVKSKHGLLTTIAWGVDGKVTY
ALEGSIFIGGASVQWLRDELKIIESAKDSEMYANRVEDTNGVYVVPAFTGLGAPYWDMYA
RGSILGLTRGAKKEHIVRATLESIAYQTKDVLEAMQNDSKLKLKSLKVDGGASNNNFLMQ
FQSDILNVDIDRPKIVETTALGAAYLAGLSVGFYIGRNEITSKWSVEKEFNPNMSEEKRC
KLYKGWKKAVSRALSWEKEDELDI
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atggaaaagaagtatgtaatggcattagaccaaggaacaaccagttcaagagctatacta
tttaataaaaaaggcgaaatagtgaaaattgcacaaaaagagttcaatcaaatttatcca
aaagctggatgggtagagcatgaccctatggaaatatgggggtcacaaagtggtgtaatg
agagaagttatagaaacagcaggtataagaccagaagaaattgcttcaatagggataact
aatcaaagagagactacggttgtttggagtaggtatactggtaaacctatttataacgca
atagtatggcagtgtaggagaacatcagaaatatgtgatgaacttaaaaataaaggattg
gaagaatcaataaaagaaaaaacaggtcttttaatagatgcatacttttcagcaacaaaa
gtaaaatggatattagataatgtagaaggagctagggaaaaagcagaacaaggagagtta
ttatttggaactatagatacatggttaatatggaatttaactcgtgggaaagtacatgta
acagattactcaaatgcatctagaacaatgatgtacaatataaatgatttagaatgggat
gaggatatattacgagaattggacataccaataagcatgttgccattagtaaaaccttct
agctatgtttatggtcatacagatgagcgcatgttatcaggagctaaaatacctattgca
ggatgtgctggagaccaacaagcagcattatttggtcaaaattgtgttgaagaaggtact
gcaaaaaatacttatggaacgggttgtttcttacttatgaatacaggcagtaacatagtt
aaatctaagcatgggttacttacaacaattgcttggggagttgatggaaaagtaacatat
gcattagaaggaagtatatttattggaggagcatctgttcaatggcttagagatgaatta
aagataattgaatctgcaaaagatagtgaaatgtatgcaaatagggtagaggatactaat
ggtgtatatgtagtgccagcatttacaggtcttggagctccatattgggatatgtatgct
aggggttcaattttaggacttacaagaggagcaaaaaaagaacatatagtaagagccaca
ttggaatcaattgcttatcagacaaaggatgttttagaagcaatgcaaaacgattcaaaa
ttaaaactaaaatcattaaaagttgatggtggagcaagtaataataattttttaatgcaa
tttcaatcagatatattaaatgtagatatagatagacccaaaatagtagaaactacagct
ttaggagctgcttatttagcagggttgtctgttggattctatattggaagaaatgaaatt
acttcaaagtggtcagtagaaaaagagtttaatccaaatatgagtgaagagaagagatgt
aaattatataaaggatggaaaaaagctgtatcgagagctttaagctgggaaaaagaagat
gaattggatatttaa

DBGET integrated database retrieval system