KEGG   Peptoclostridium difficile BI1: CDBI1_06745Help
Entry
CDBI1_06745       CDS       T01779                                 

Gene name
folE
Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
cdg  Peptoclostridium difficile BI1
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cdg00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    CDBI1_06745 (folE)
Enzymes [BR:cdg01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     CDBI1_06745 (folE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1550669..1551241
Genome map
AA seq 190 aa AA seqDB search
MNKVDKEKIQHAVREILEAIGEDPDREGLIETPNRVARMYEEIFSGLSEEPRDHLKVLFA
DEKHEELVLVKDIPFYSCCEHHLVPFFGKAHIAYLPKGGRLTGLSKLARVIDTLAKRPQL
QERITKNAADIIMEELQPYGVLVVVEAEHMCMTMRGVKKPGSKTVTSAVRGIFEKDIASR
AEAMSLITMK
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atgaataaagttgataaagaaaagatacaacatgcagtaagagaaatactagaggcaatt
ggagaagacccagatagagaaggtctaatcgagactccaaatagagttgctaggatgtat
gaagagatattctctggtcttagtgaagaaccaagagaccatttaaaagttctttttgca
gatgaaaaacatgaagaattagtattggtaaaagatattccattttattcatgttgtgag
catcatctagttcctttctttggaaaagctcatattgcttatttaccaaaaggaggaaga
cttacagggctttctaaacttgctagagtaatagatacattggcaaaaagaccacaatta
caagaaagaatcactaaaaatgctgcagatataataatggaagaattacaaccttatggt
gtcttagtagtagtagaagctgaacatatgtgtatgacaatgagaggtgtaaaaaaacca
ggttcaaaaactgttacatcagcagtgagaggaatatttgaaaaggacattgcgtctaga
gccgaggctatgagtttgattactatgaagtag

DBGET integrated database retrieval system