KEGG   Peptoclostridium difficile BI1: CDBI1_06750Help
Entry
CDBI1_06750       CDS       T01779                                 

Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
cdg  Peptoclostridium difficile BI1
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cdg00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    CDBI1_06750
Enzymes [BR:cdg01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     CDBI1_06750
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1551307..1552098
Genome map
AA seq 263 aa AA seqDB search
MFDYGKRTYIMGILNVTPDSFSDGGDFNNLDIAIQHAKDMVDQGADIIDLGGESTRPGHS
YVDSDEELRRVIPVIKKLKQELEIPISIDTYKADVAEEALKLGVTMVNDVWGLRKDKNMA
SVIGKYDAEVCIMHNQDGTNYDKDIMESIKDFFKVSIEMAMSCGVKKEKIVLDPGVGFGK
DFEQNIEVLRRLNELKDLGYPILLGTSRKSVIGKVLPVEPKKRLEGTIATTVLGIRDGVD
IVRVHDVYENLMAARMTDAIYRK
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
gtgtttgattatggtaaaagaacttatataatgggaatattaaatgtaactccagatagt
ttttctgatggaggagattttaataacttggacatagcaatacaacatgcaaaagatatg
gttgaccaaggtgcagatataatagacttaggaggagagtctacacgcccaggtcatagc
tatgtagactcagacgaagagctaagaagagtaatccctgtaataaaaaaacttaaacag
gaattggagataccaatatcaatagacacttataaggcagatgttgcagaagaagcatta
aaattaggtgtcactatggtaaatgatgtttggggtcttagaaaagataaaaatatggct
tctgtaataggaaaatatgatgcagaagtgtgtataatgcataatcaagatgggacaaac
tatgacaaagatataatggagtcaataaaagacttttttaaggtaagtatagaaatggca
atgagttgtggtgtaaaaaaagaaaaaatagtacttgacccaggcgtaggatttggcaag
gattttgaacaaaatattgaagtattgagaagattaaatgaattaaaagatttagggtat
cctattttgcttgggacatccagaaaatcagtaataggaaaagtacttccagttgagcct
aaaaaaagattagaaggtacaatagctactactgttcttggtataagagatggcgtagat
atagttagagtacatgatgtttatgaaaatttaatggcagctagaatgactgatgcaata
tatagaaagtag

DBGET integrated database retrieval system