KEGG   Clostridium difficile BI1: CDBI1_06750Help
Entry
CDBI1_06750       CDS       T01779                                 

Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
cdg  Clostridium difficile BI1
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:cdg00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1551307..1552098
Genome map
AA seq 263 aa AA seqDB search
MFDYGKRTYIMGILNVTPDSFSDGGDFNNLDIAIQHAKDMVDQGADIIDLGGESTRPGHS
YVDSDEELRRVIPVIKKLKQELEIPISIDTYKADVAEEALKLGVTMVNDVWGLRKDKNMA
SVIGKYDAEVCIMHNQDGTNYDKDIMESIKDFFKVSIEMAMSCGVKKEKIVLDPGVGFGK
DFEQNIEVLRRLNELKDLGYPILLGTSRKSVIGKVLPVEPKKRLEGTIATTVLGIRDGVD
IVRVHDVYENLMAARMTDAIYRK
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
gtgtttgattatggtaaaagaacttatataatgggaatattaaatgtaactccagatagt
ttttctgatggaggagattttaataacttggacatagcaatacaacatgcaaaagatatg
gttgaccaaggtgcagatataatagacttaggaggagagtctacacgcccaggtcatagc
tatgtagactcagacgaagagctaagaagagtaatccctgtaataaaaaaacttaaacag
gaattggagataccaatatcaatagacacttataaggcagatgttgcagaagaagcatta
aaattaggtgtcactatggtaaatgatgtttggggtcttagaaaagataaaaatatggct
tctgtaataggaaaatatgatgcagaagtgtgtataatgcataatcaagatgggacaaac
tatgacaaagatataatggagtcaataaaagacttttttaaggtaagtatagaaatggca
atgagttgtggtgtaaaaaaagaaaaaatagtacttgacccaggcgtaggatttggcaag
gattttgaacaaaatattgaagtattgagaagattaaatgaattaaaagatttagggtat
cctattttgcttgggacatccagaaaatcagtaataggaaaagtacttccagttgagcct
aaaaaaagattagaaggtacaatagctactactgttcttggtataagagatggcgtagat
atagttagagtacatgatgtttatgaaaatttaatggcagctagaatgactgatgcaata
tatagaaagtag

DBGET integrated database retrieval system