KEGG   Peptoclostridium difficile BI1: CDBI1_06760Help
Entry
CDBI1_06760       CDS       T01779                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
cdg  Peptoclostridium difficile BI1
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cdg00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    CDBI1_06760
Enzymes [BR:cdg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     CDBI1_06760
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1552467..1552973
Genome map
AA seq 168 aa AA seqDB search
MNKAYLGIGTNMGDRFDNLSRACELLKNSDSIYKVKESSLYETKPWGYTEQADFLNMCVE
IETEFEPYELLEYCQEIERELHRERIVHWGPRTIDVDILFFNDVASTDERLTIPHPRIQD
RAFVLIPLMDLNEELIINEKTVKEHLNLLSAEEREEVKELVGYERKPI
NT seq 507 nt NT seq  +upstreamnt  +downstreamnt
atgaataaggcttatttgggaataggtactaacatgggtgatagatttgataatttatca
agagcatgtgaacttttgaaaaatagtgattctatatataaagtaaaggaatcaagttta
tatgaaacaaaaccatggggatatacagaacaagcagattttctaaatatgtgtgtagaa
atagaaacagaatttgaaccttatgagttgttagaatattgtcaagaaatagagagagaa
ctacacagagagagaatagttcattggggaccaagaactatagatgtagacatactattt
tttaatgatgtagcttccactgatgaaagactaacaatacctcatccgaggattcaagat
agagctttcgttttgataccacttatggatttaaatgaagaacttataataaatgaaaaa
acagtaaaagaacatttaaacctcctatctgctgaagaaagagaagaagtaaaggagctt
gtaggttatgaaagaaaacctatttaa

DBGET integrated database retrieval system