KEGG   Clostridium difficile BI1: CDBI1_07775Help
Entry
CDBI1_07775       CDS       T01779                                 

Definition
histidinol dehydrogenase
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
cdg  Clostridium difficile BI1
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:cdg01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:cdg00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1758323..1759588
Genome map
AA seq 421 aa AA seqDB search
MKSIKTSSMKEKVDEKILREQVSSIIEDIRNNKDVALKKYNEKFDRNTRDEFRITKEEIK
EAYKHVDDEFINNLKIAAKNIREFAKAQKLSFENPFEKEIYPGVILGQTNIPIESCLAYV
PGGQYPLFSTALMLIIPAKVAGVKRIVACSPTMKNTEKINPKTLVAMDIAGADEIYATGG
VQAIAAFTYGTEKINPVDIIVGPGNKFVTEAKRQCYGQVGIDFVAGPSEVLIIADETSNP
VYIAADLLAQCEHDLNARGILLTNSLEVAQKVEKNIESMLKDLPTKDIAYSSWENNGEII
LVDDMEEAIKISNFYAPEHLEVAVNEYNDICDRLTNYGSLFIGNLSAEVFGDYVSGTNHT
LPTLKASRYTGGVWVGTFIKTCTKQIFNEKAIQSLAPVAEKLAKEEGLYAHAKAAEVRFK
K
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagtattaaaacatcaagtatgaaagaaaaggtagatgaaaagatattaagagag
caagtaagttctataatagaagatataagaaataataaggatgttgcacttaaaaaatat
aatgagaagtttgatagaaatacaagagatgaatttagaattactaaggaagaaataaag
gaagcttataagcatgtagatgacgaatttataaataacttaaagattgctgccaaaaat
ataagagaatttgctaaagctcaaaaactaagttttgaaaacccttttgaaaaagaaatt
tatccaggtgtaatcttaggtcaaactaatattccaatagagtcatgtcttgcatatgtt
ccaggaggtcagtatccattgttttcaacagctcttatgcttataatacctgcaaaagta
gcaggagtaaaaagaatagtggcatgttcaccaactatgaaaaatactgaaaagataaat
cctaaaacattggtagctatggatatagcaggtgctgatgaaatatatgcaactggagga
gttcaagctatagcagcatttacatatggaacagaaaagattaatccagttgacataatt
gtaggaccaggaaataagtttgtaactgaagctaaaagacaatgttatggacaagtagga
attgattttgtcgctgggccaagtgaagttcttataatagcggatgaaacttcaaatcca
gtttatattgcagctgatttattagcacaatgtgagcatgatttaaatgcaagaggaata
ttattgacaaatagcttggaagtagcacaaaaagttgaaaaaaatatagaaagtatgcta
aaagatttgccaacaaaggacatagcatatagttcatgggaaaataatggagagataata
ttggttgatgatatggaagaagccattaaaataagtaatttttatgcaccagaacattta
gaagttgcagtaaatgagtataatgatatttgtgatagattaactaactatggttcttta
tttattggaaatctttctgctgaggtgtttggtgactatgtttcaggtaccaatcataca
ttaccaacacttaaagcatcaagatatactggtggtgtttgggttggaacttttatcaaa
acttgtacaaagcagatatttaatgaaaaagctatacaatcattagcacctgtagctgaa
aagctggcaaaagaagagggattatatgcacatgcaaaggctgctgaggttaggtttaaa
aagtag

DBGET integrated database retrieval system