KEGG   Clostridium difficile BI1: CDBI1_11315Help
Entry
CDBI1_11315       CDS       T01779                                 

Definition
succinate-semialdehyde dehydrogenase
Orthology
K18119  
succinate-semialdehyde dehydrogenase [EC:1.2.1.76]
Organism
cdg  Clostridium difficile BI1
Pathway
Butanoate metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:cdg00650]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(2547662..2549053)
Genome map
AA seq 463 aa AA seqDB search
MEKAVENFEDLSKEYINGYIERARKAQREFECYTQEQVDKIVKIVGKVVYYNAEYLAKLA
VEETGMGVYEDKVAKNKSKAKVIYNNLKDKKSVGIIDIDRETGITKVAKPVGVVAAITPC
TNPIVTPMSNAMFALKGRNAIIITPHHKAIGCSTKTVEMINEELEKIGAPENLIQILDQQ
SRENTRNLISSADVVIATGGMGMVKAAYSSGKPALGVGAGNVQCIIDRDVDIKEAVPKII
AGRIFDNGIICSGEQSVIVAEEMFDKIMDEFKNNKGFIVRDKVQKEAFRNAMFVNKSMNK
DAVGQSVHTIAKIAGVEIPEDTKIIVIEADGPGEEDIIAKEKMCPVISAYKYKSFEEGVA
IAKANLNVEGKGHSVSIHSNTVKNIEYAGENIEVSRFVINQCCATSAGGSFFNGLAPTNT
LGCGSWGNNSISENLDYKHLINISRIAYYMPENEVPTDEELWG
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaagcagtggaaaactttgaagatttaagtaaggaatacattaatggttatatt
gagagagcaagaaaagctcaaagagagtttgaatgttatactcaagaacaagtagataaa
atagtaaaaatagttggaaaagtagtgtattataatgctgaatatttagctaaacttgct
gtagaagagactggaatgggagtatatgaagataaggtagctaaaaataaaagcaaagca
aaagttatatataacaatttaaaagataaaaaatcagttggtataattgatatagataga
gaaactggaataacaaaggtagctaaaccagttggagtagtagcggcaataactccttgt
acaaatccaatcgttacacctatgagcaatgcaatgtttgcacttaagggaagaaatgca
attattatcacacctcatcataaagcaattggatgtagtacaaaaactgtagagatgatt
aatgaagaattagaaaaaataggagctccagaaaatttaatacaaatacttgaccaacaa
tcaagagaaaatacaagaaatttaatttcatcagcagatgtagtaattgccactggagga
atgggaatggtaaaagctgcgtactcaagtggaaaaccagcacttggtgtaggggcagga
aatgttcaatgtatcatagatagagatgtagacattaaagaagcagtacctaaaatcata
gcaggaagaatttttgataatggtatcatttgttcaggtgaacagtcagtaatagtagca
gaagaaatgtttgataaaataatggatgaatttaaaaataacaaaggttttatagttaga
gataaagtacaaaaagaagctttcagaaatgctatgtttgtaaataaatctatgaataaa
gatgcagtaggtcaatcagttcatacaattgcaaaaattgcaggtgttgagataccagaa
gatacaaaaataatagtaatagaagctgatggaccaggagaagaggatattattgcaaaa
gaaaaaatgtgtccagttatatctgcatacaagtataaaagttttgaagaaggtgtagct
attgcaaaagcaaatttaaatgtagaaggaaaaggacatagtgtatctatacattcaaat
acagttaaaaatatagaatatgcaggagaaaatatagaagtatcaagatttgttattaat
caatgttgtgctactagtgctggaggaagtttctttaatggtcttgcacctactaatact
ctaggttgtggttcttggggaaataacagcatctctgaaaatcttgattataagcatcta
attaatatttctagaattgcttattatatgccagaaaatgaagtccctacagatgaagaa
ctttggggataa

DBGET integrated database retrieval system