KEGG   Peptoclostridium difficile BI1: CDBI1_11955Help
Entry
CDBI1_11955       CDS       T01779                                 

Definition
glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
cdg  Peptoclostridium difficile BI1
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cdg00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CDBI1_11955
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CDBI1_11955
   00052 Galactose metabolism
    CDBI1_11955
   00500 Starch and sucrose metabolism
    CDBI1_11955
   00520 Amino sugar and nucleotide sugar metabolism
    CDBI1_11955
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    CDBI1_11955
   00524 Butirosin and neomycin biosynthesis
    CDBI1_11955
Enzymes [BR:cdg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     CDBI1_11955
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(2679396..2680331)
Genome map
AA seq 311 aa AA seqDB search
MYYIGVDIGGTGIQAGVVDNYGKIIFRSECKTVIEKGFEGILNDIKIMIYKLLEDNKLTM
SDIKSIGFGVPGFINKEGLVTCVNLKWNKKAFNKELKRRFPDAEIHGENDATVAALGEAK
FGSMKGANVGVLYTLGTGVGGGIVINQKVFSGAHGLGSEIGHQIIGENYFNCNCGNNGCV
ETFCSATAIIKYSQKLIEEGEKSRILDLAEGNLENVNAKMVFDAYRENDLVAIKVINRFK
DYLAKTFANTINSLDPEIISIGGGISKSSDIILDGIEDLVRKFVLYKTEDIATITCATLG
SDAGIIGAAFL
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgtattatataggtgtagacataggaggaacaggtatacaagcaggagtagttgataac
tatgggaagataatttttaggtcagagtgtaaaacagtaattgaaaaaggctttgaagga
atacttaatgacataaaaataatgatttataagttgttggaagataataaacttactatg
agtgacataaaatctattggatttggtgttccaggttttataaataaagaaggattagta
acttgtgtaaatttaaaatggaataaaaaagcttttaataaagagttaaaaagaagattt
ccagatgctgaaattcatggagaaaatgatgcaacagtagcagcacttggagaagcaaag
tttggaagtatgaaaggtgctaatgttggagtattatatactttaggaactggtgtaggt
ggaggaatagtaattaatcaaaaagtcttttctggagcacatggattgggttcagaaata
ggtcatcaaattataggagaaaactattttaattgtaattgtggaaataatggttgtgta
gaaactttttgttcagcaactgcaattataaagtattctcaaaaactgatagaagaagga
gaaaagagtaggattttagatttggcagagggaaatttagaaaatgtaaatgcaaagatg
gtgtttgatgcatatagagaaaatgatttagtggcaattaaagtaataaatagatttaaa
gattatttagcaaaaacttttgcaaacacaataaattctttagacccagaaattatatct
ataggaggaggcatttctaaatctagcgatataatacttgatggaatagaagatttggta
agaaaatttgtattatacaaaacagaagatatagctacaattacatgtgcaactttaggt
tcagacgcaggaattataggagcagcttttttataa

DBGET integrated database retrieval system