KEGG   Peptoclostridium difficile BI1: CDBI1_12275Help
Entry
CDBI1_12275       CDS       T01779                                 

Definition
1,4-alpha-glucan branching enzyme
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
cdg  Peptoclostridium difficile BI1
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cdg00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CDBI1_12275
Enzymes [BR:cdg01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     CDBI1_12275
Exosome [BR:cdg04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CDBI1_12275
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
2756482..2758485
Genome map
AA seq 667 aa AA seqDB search
MKSQKRFKILDIDVYLQPFESDIKKRMKHYEDMKSKTLKNYKDFSSFANAHLYYGFHQTN
DGFFYREWAPNADSLSLIGDFNNWNRKSHPLRKIGSGNWEIFIPGQNSLPHKSEVKVQVT
ANGKTFDRIPLYIKRVIQKDFGGFNGQIWQPKTPFIWTDNNFDLKNITSPLIYECHIGMS
TESESIGTYNEFTEKILPKIKKAGYNTIQLMAIMEHPYYASFGYQVSNFYAISSRFGTPE
DLKNLINTAHSMGIAVLLDLVHSHAVKNTLEGINEFDGSEHQFFHSGSKGNHPAWGTKLF
NYGKPEVIHFLLSNIKFWLNEYHFDGFRFDGVTSMLYHNHGLGVSFDSYEKYFSMNTDIE
AITYLQFANELIKEIKPNSISIAEDMSGMPGMCIPIKDGGIGFDYRLAMGVPDFWIKTIS
NLSDEDWDLGKMWYELTTRRPGEKNIGYCESHDQALVGDKTIIFWLADKEMYWNMEINSN
NHVINRAISLIKLIKLITFSLAGEGYLNFMGNEFGHPEWIDFPREGNNWSYKYARRQWSL
SEDNNLKYKQLLNFDKSMLELTKYSDIFIQNSHELIHMDNDKKILVYSKGKYLFIFNFHP
NLIQSVDISKFQNTNYKTILNTDMVEFGGNTKKENLRDYDVYFSSTPPSSKMPIASRTAI
VLLDNGI
NT seq 2004 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagtcaaaaaagatttaaaattttagatattgatgtatacctacaaccatttgaa
tctgatataaaaaagcgaatgaaacattatgaggatatgaaatcaaaaacattgaaaaac
tataaagattttagttcttttgcaaatgctcatctttactatggatttcatcagacaaat
gatggattcttctatagggaatgggctccaaatgcagatagtttgtcactaattggtgac
tttaataattggaatagaaaatctcatcctctaagaaaaattgggtctggtaattgggaa
atatttattcctggtcaaaatagcttacctcacaaatcagaggtaaaggtacaagttact
gcaaatggaaaaacatttgaccgtataccattatatataaaaagagtaattcaaaaagat
tttggtggatttaatggacaaatatggcaaccaaaaactccatttatctggactgacaat
aattttgacttaaaaaacataacttctccactaatctatgaatgtcatataggtatgtct
actgaaagcgaatctattggaacttataatgaatttactgaaaaaatacttcctaagata
aaaaaagctggatacaataccattcagcttatggctattatggaacatccatattatgca
tcttttggataccaagtttcaaacttttatgcaatctcatctaggtttggtactcctgaa
gacttaaaaaacctcataaacactgctcattcaatggggattgctgttttattggattta
gttcattctcatgctgtaaagaatactttagaaggaataaatgagtttgatggaagtgaa
catcaatttttccactcaggttcaaagggaaatcatcctgcttggggtacaaaacttttt
aactatggtaaacctgaagtaatacattttttgctttcaaatataaaattttggttaaat
gagtaccattttgatggctttaggtttgatggtgtgacttcaatgttatatcataaccat
ggtcttggagtttcatttgatagttatgaaaaatattttagtatgaatacagatattgaa
gctataacatatctccaatttgcaaatgaattaataaaagaaattaaacctaattcgata
agtattgcagaagatatgagtggaatgcctggtatgtgtatccctataaaagacggcgga
attggatttgactatagactcgcaatgggagtacctgatttttggataaaaactatctct
aacttatctgatgaagactgggatttgggaaaaatgtggtatgaacttactactagacga
cctggagaaaaaaatataggatattgtgaatcccatgaccaagcattagttggcgataaa
acaattattttttggctagctgacaaggaaatgtactggaatatggaaataaactcaaat
aaccatgttatcaatagagcaatatctcttattaaattaattaaattaataactttttct
ctagcaggtgaaggatatctaaattttatgggaaatgaatttggacatcctgagtggatt
gattttccacgagaaggcaacaattggagctataagtatgccagaagacaatggagcctt
tcagaagataacaacttaaagtataaacaattattaaattttgataaatctatgctcgaa
cttacaaaatacagtgatatttttatccaaaatagtcatgaacttatacatatggataat
gataaaaagattttggtgtacagtaagggcaaatatttatttatatttaatttccaccct
aatctaatacaatcagttgatatttcaaagtttcaaaatacaaactacaaaacgatatta
aatactgatatggtagagtttggaggaaacacaaaaaaagaaaacttaagagattatgat
gtatactttagctcaactcctccttcttctaaaatgcctattgcctctcgtacagcaata
gtacttttagataatggcatttaa

DBGET integrated database retrieval system