KEGG   Peptoclostridium difficile BI1: CDBI1_12370Help
Entry
CDBI1_12370       CDS       T01779                                 

Definition
endoglucanase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
cdg  Peptoclostridium difficile BI1
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cdg00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CDBI1_12370
Enzymes [BR:cdg01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     CDBI1_12370
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(2780949..2781971)
Genome map
AA seq 340 aa AA seqDB search
MFGGINIKRIGIIIMFFLSIAFIGFYLAIRGNSDTVKMQRGINIGNALESPKDFPWDVKM
SNKFFDDIKDAGFDTVRIPVRFSDYTSDSDNFKIDEEFFKKIDKYVDYALDKDLIVVLDL
HHFEEIMKEPRVHKEEFLKIWQQIANRYQKYDKKLVFELLNEPKENLSSQLLNEYIEEAI
KIIRKTNPKRTIIVGPYNFYQIDYLNELNVPKDSNIVVSFHYYEPNDFAFQGNIYHNGFE
HLSNITWEGTNEQMDYLKKRFDIVENWANKNKVKIFLGEFGVTKEAPEASRRAWIKAVRE
EAEKRNFSWAYWELASGFGIYNQIEGTWDRDILSALIEKR
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
ttgtttggggggattaatataaaaagaataggtattattataatgttttttttaagtata
gcttttattggattttatcttgcaataagaggtaacagtgatacagttaagatgcaacga
gggataaatataggtaatgcactagaatcacctaaggattttccgtgggatgtaaaaatg
tcaaataagttttttgatgatataaaagatgcaggttttgacacagtacgtataccagta
aggttttctgattatacgtcagattctgataattttaaaattgatgaagaattttttaaa
aagattgataaatatgtagattatgcattggataaagacttaatagttgtgttggattta
catcattttgaagaaattatgaaagaaccaagagttcataaagaagagtttttaaaaata
tggcaacagatagctaataggtatcaaaaatatgataaaaaattggtatttgaattatta
aatgaacctaaagaaaatttatcttcacaattactaaacgaatacattgaagaagcaata
aagataattagaaaaactaaccctaaaagaactattatagtgggaccatataatttctat
caaattgattatttgaatgaattaaatgttccaaaagattctaatatagtagtttctttt
cactattacgaaccaaatgattttgcatttcaaggaaacatttatcataatggatttgag
cacttgagcaatattacttgggaaggaacaaatgaacaaatggattatttaaaaaaaagg
tttgatattgtagaaaattgggcaaataaaaataaggtaaaaatattcttgggtgaattt
ggagtaacaaaagaagcaccagaagcttcaagaagagcttggataaaagctgtaagagaa
gaagctgaaaaacgaaacttttcatgggcttattgggagcttgcttctggatttggtata
tacaatcaaattgaagggacttgggatagagacatattaagtgcattaatagaaaagagg
tga

DBGET integrated database retrieval system