KEGG   Clostridium difficile BI1: CDBI1_12965Help
Entry
CDBI1_12965       CDS       T01779                                 

Gene name
murE
Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase (EC:6.3.2.13)
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
cdg  Clostridium difficile BI1
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:cdg00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:cdg00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(2919627..2921081)
Genome map
AA seq 484 aa AA seqDB search
MKLNDIIQGLDIINVKGELNIDINNVQYNSRKVTKGTLFICIKGFVSDGHKYIKDAIEKG
ASAFLVEEDVEIKGCTFIKVKDTRKDMAKVADNFYNHPSQKFNVIGVTGTNGKTSITTIL
NEILTLNKNKVGLIGTIKIFDGEKDIVSNSTTPESIDLQYHFNNMLDNGCDYCAMEVSSH
SLALNRVDETDFKLGIFTNLTPDHLDFHKDLEDYRKAKEKLFFKTTMANIINIDDEGGKK
IYENIKGINVPCYTYGVDTKADFMARDIKSDSDGVSYRLITPSYEEVIFIPVPGMFTVYN
TLAVIAACYVLGIPKPIYKEGLRLSNGVSGRFETVPNDKGISVIVDYAHTPDALENVLKT
TQQFAEGKIISVFGCGGDRDTEKRPLMGAIGQKYSDLCIITSDNPRTEEPEAIIKDILEG
IDKKKENYHVVVDREQAIAEAISMAKKDDVVIITGKGHETYQIIGKVKHHFDDKEVANEC
LSKM
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgaaattaaatgatattatacaggggttggatataatcaatgtcaagggtgaattaaat
atagatattaataatgtacaatataattcaagaaaggttacaaaaggtacattatttata
tgtataaaaggatttgtgtcagatggtcataagtatataaaagatgccatagaaaaggga
gcaagtgcatttcttgttgaagaagatgtagaaataaaaggatgtacatttataaaggta
aaagatacaagaaaagatatggcaaaagtagctgataatttttataatcatccatctcag
aaatttaacgttataggagttacaggtactaatggaaaaactagtataactactatacta
aatgagatattaactttaaataagaataaagttggacttataggaactataaaaattttt
gacggagaaaaagacattgtttccaattcaacaactccagaaagtatagatttacaatat
cattttaataatatgttggataatggatgtgactactgtgcgatggaagtttcatcacat
tcattggcattaaatagagttgatgaaacagactttaaactaggcatatttacaaattta
acaccagaccatttagattttcataaagatttagaggattatagaaaagcaaaagaaaaa
ttattttttaagactactatggcaaatataataaacatagatgatgaaggtggaaaaaag
atatatgaaaatataaaaggtataaatgtaccttgttacacttatggtgttgatactaag
gctgattttatggctagagatataaaatcagattcggatggagtatcttatagattaata
acaccttcatatgaagaagtaatatttataccagttccaggaatgtttacagtatataat
actttagcagttatagctgcttgctatgtacttggcatacctaaaccaatatataaagaa
ggtcttagactttctaatggagtatcaggaaggtttgaaacagttccaaatgataaaggt
ataagtgtaattgtagactatgctcatactcctgatgcacttgaaaatgtactaaagaca
actcaacaatttgcagaaggaaaaataatttctgtgtttggatgtggtggagatagagat
actgaaaagagacctttgatgggagcaattggacaaaaatattctgatttatgtattata
acttctgataatccaagaactgaagaaccagaggcaataataaaagatatacttgaagga
attgacaagaaaaaagaaaattaccatgttgttgttgatagagaacaagctatagcagaa
gctataagtatggcaaaaaaggatgatgttgtaattataacaggtaagggacatgaaact
tatcaaattataggtaaagttaagcatcattttgatgataaagaagttgcaaatgagtgt
ttaagtaaaatgtag

DBGET integrated database retrieval system