KEGG   Peptoclostridium difficile BI1: CDBI1_13035Help
Entry
CDBI1_13035       CDS       T01779                                 

Definition
3-hydroxybutyrate dehydrogenase (EC:1.1.1.30)
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
cdg  Peptoclostridium difficile BI1
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cdg00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    CDBI1_13035
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    CDBI1_13035
Enzymes [BR:cdg01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     CDBI1_13035
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
2936130..2936906
Genome map
AA seq 258 aa AA seqDB search
MVKDKVVFVTGAASGIGKQIAESFLKNGAKVMFSDINQEALNNTITELQKKGYDCMSVKC
DVTKEEEINHAIDKTVEKYGRLDILINNAGLQHVSMIEDFPTDKFEFMIKIMLTAPFIAT
KKAFPIMKKQGFGRIINMASINGVIGFAGKAAYNSAKHGLIGLTKVAALEAADSGITVNA
LCPGYVDTPLVRGQFNDLSKTRNIPLENVLEEVLYPLVPQKRLLDVQEIADYAMFLASDN
AKGITGQACLLDGGYTAQ
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atggttaaagataaagttgtattcgtaacaggagctgcaagtggaataggtaaacaaata
gctgaatcgttcttaaaaaatggtgctaaagtaatgttctctgatataaatcaagaagct
ttaaataataccataacagagttacaaaaaaaaggttatgattgcatgagtgtaaagtgt
gatgtaactaaggaagaagaaattaaccacgctatagataaaactgttgaaaagtatggc
agattagatatattaataaacaatgctggacttcaacatgtttctatgatagaagatttc
ccaactgataaatttgaatttatgataaaaataatgctgacagcaccttttatagctact
aaaaaagcatttcctataatgaaaaaacaaggctttggtcgtataataaatatggcctca
atcaatggtgtaataggatttgctggaaaggctgcttataactcagcaaaacatggactt
attggactaacaaaagttgctgctcttgaagctgccgattctggtataacagttaatgct
ttatgccctggatatgtagatactccacttgtcagaggtcagtttaatgacctttcaaaa
actcgtaatataccattagaaaatgtcttagaggaagttttgtacccacttgtaccacaa
aaacgcctattagatgttcaagaaattgccgactatgctatgttcctagcaagtgataat
gctaagggtattacaggacaagcttgcttactagatggaggatatactgcacaatag

DBGET integrated database retrieval system