KEGG   Clostridium difficile BI1: CDBI1_14845Help
Entry
CDBI1_14845       CDS       T01779                                 

Definition
6-phospho-beta-glucosidase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
cdg  Clostridium difficile BI1
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:cdg00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(3384961..3386409)
Genome map
AA seq 482 aa AA seqDB search
MSKFPKDFLWGGAVAANQLEGAWNEGGKGWCLADVHMYDKDRDISKHYESDMTVDKIKFA
MKDNNGYYPKRNGIDFYHTYKEDLKLLKELGLKCFRFSINWARIFPNGDDLEPNEEGLKF
YDNLINEVIDNGMEPIVTLLHYETPLNLVLKYKGWSNRKVVDFFVRYAELILNRYKDKVK
YWIVINQINLMYHESFNSVAFCVDQVDDVEEAKYQAIHHQFMATALTKKLGKEINSDMMI
GMMMADCTSYPEDCDPENVVFALKRNRIQYFFTDVSFRGEYPAYIKRFFKENNINIVMEE
GDDKVLKENTMDFLALSYYYSTTVSASKNTMNPIDNVKNQYLKANPWGWAIDPKGLYNTL
SQYYDRYQKPIMIAENGFGMHDKFEDGKVHDSYRIDYLGKHIEQIGEAIADGTEILAYCM
WSPIDIVSCSSQEMEKRYGFIYVDIDNNGNGSKERYKKDSFYWYKNVIRTNGEELKEKVD
SF
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
ttgagtaagtttcctaaagattttttgtggggtggagctgtagcagctaatcaattagaa
ggtgcttggaatgaaggtggcaaagggtggtgcttagctgatgtacatatgtatgataaa
gatagagatatatctaaacattacgagtctgatatgactgtagataaaataaagtttgct
atgaaagataataatgggtattatcctaagcgtaatggaatagacttttatcatacatac
aaagaagatttaaagcttttgaaagaactagggttaaagtgttttagattttcaataaat
tgggctagaatatttccaaatggagatgatttagagcctaatgaagagggattaaagttt
tatgataatcttataaatgaagtaatagataatggtatggaacctattgtaacactactc
cattatgagactcctttgaatttagtattaaaatataaaggatggtctaatagaaaagta
gtggatttctttgttagatatgcagaattaatattaaatagatacaaagataaagttaaa
tattggatagttataaaccaaataaatttaatgtatcatgaatcatttaattcagttgca
ttttgtgtagaccaggtagatgatgtagaagaggccaaatatcaagctattcatcatcaa
ttcatggctacagctttaactaagaagcttggaaaagaaataaattcagatatgatgata
gggatgatgatggcagattgtacatcttatccagaagattgcgaccctgaaaatgtagta
tttgctttaaaaagaaatagaatacaatatttttttactgatgtaagttttagaggggag
tatccagcttatattaagagattcttcaaagaaaataacataaatatagttatggaagaa
ggtgatgataaagtgttaaaagagaatactatggattttctagctctatcatactattac
tctacaacagtatcagcaagtaaaaataccatgaatccaattgataatgtaaaaaatcaa
tacttaaaagcaaatccttgggggtgggcaattgaccctaaaggattatacaatacttta
tctcaatattatgatagatatcaaaagccaataatgatagctgaaaatggatttggaatg
catgataaatttgaagatggaaaagttcatgatagttatagaatagattatttaggaaaa
catatagaacaaataggtgaagctatagctgatggaaccgaaatattagcttattgtatg
tggtcgccaatagatatagtaagttgttcatctcaagaaatggaaaaaagatatggattt
atatatgtagatatagataacaatggaaatggaagcaaagaacgttacaaaaaagatagt
ttttattggtataaaaatgtaataagaactaatggagaagaattaaaagaaaaagtagat
agtttttaa

DBGET integrated database retrieval system