KEGG   Clostridium difficile BI1: CDBI1_14995Help
Entry
CDBI1_14995       CDS       T01779                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
cdg  Clostridium difficile BI1
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:cdg01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:cdg01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:cdg00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:cdg00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:cdg00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:cdg00052]
Metabolism; Energy metabolism; Methane metabolism [PATH:cdg00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
3426315..3427529
Genome map
AA seq 404 aa AA seqDB search
MRNCIIAQSGGPTAVINASAVGIYEKNLETKYFDKVYFGINGIEGILNKNIIDSDSLNKD
NVLNLKQTPSSGLGSCRYKLADYKINSYDYDRVINILDEYEIDTLFYIGGNDSMDTVMKF
SQYCKNTTCKIKFIGIPKTIDNDLLGTDNCPGFGSAAKLISTLIMETYLDFSIYKNNGIF
IVETMGRDTGWLAASSSLARLNDTPLVDLIYLPEIDFYEDKFIEDVRKIFKEKNKAYIVA
SEGIRDKYGNFICEQKTSAHDKFGHSQLGGVSNYLKNLIVSSSITTRVKTLELGVIQRCA
MHLASDTDLKQAAEVGAYGIELSKKGYTGVMAIINRTCNNPYKYEVSHTDISKIANKTKY
FPKEWINEECNYITDEALNYLYPLIQGKPDIKYKNGLPYFSIIY
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgagaaactgtattattgcccaatctggaggccctacagctgttatcaatgcttctgca
gttggtatttatgaaaaaaatttagaaactaaatactttgataaagtatattttggtatc
aatgggattgaaggtatattaaacaaaaatataatagattcagactccttaaacaaagat
aatgtattaaatttaaagcaaacaccttcgtctggtcttggttcttgtagatacaaactg
gctgattataaaataaattcttatgattatgatagagttataaatatactagatgaatat
gaaatagatacattattttatataggcggaaatgattctatggacacagtgatgaaattt
tctcaatactgcaaaaacactacttgtaaaataaaatttatagggattcctaaaacaata
gataatgatttattaggaactgacaactgtcctggatttggttctgctgcaaagcttatt
tctacactaataatggaaacatacttagatttttctatatacaaaaataatggtatattt
atagtagaaaccatgggtagagatactggatggttagcagcttcttcttcactagctaga
cttaatgatactccacttgttgatttaatataccttccagaaattgatttctatgaagat
aagtttatagaagatgttagaaaaatatttaaagaaaaaaataaggcttatatagttgca
tcagaaggtataagggataaatacgggaactttatatgcgaacaaaaaacttctgctcat
gataaatttggtcattcccaattaggtggagtaagcaactatctaaagaatcttatagta
tcatcatcaattacaacaagagtaaaaaccttagaacttggtgtaatacaaagatgtgct
atgcatttagcttcagatactgatttaaaacaagcagctgaagttggtgcatatgggata
gaactatctaaaaaaggatatacaggagttatggctatcattaatagaacatgcaataat
ccttataagtatgaagttagtcatactgatatttctaaaatagctaacaagacaaaatat
tttcctaaagagtggataaatgaagaatgtaattatataactgatgaagccctaaattat
ctatatccacttattcaaggtaaaccagatatcaaatataaaaatggactaccttatttt
tcaattatttactag

DBGET integrated database retrieval system