KEGG   Peptoclostridium difficile BI1: CDBI1_14995Help
Entry
CDBI1_14995       CDS       T01779                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
cdg  Peptoclostridium difficile BI1
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:cdg00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CDBI1_14995
   01230 Biosynthesis of amino acids
    CDBI1_14995
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CDBI1_14995
   00030 Pentose phosphate pathway
    CDBI1_14995
   00051 Fructose and mannose metabolism
    CDBI1_14995
   00052 Galactose metabolism
    CDBI1_14995
  Energy metabolism
   00680 Methane metabolism
    CDBI1_14995
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    CDBI1_14995
Enzymes [BR:cdg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     CDBI1_14995
Protein phosphatases and associated proteins [BR:cdg01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     CDBI1_14995
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
3426315..3427529
Genome map
AA seq 404 aa AA seqDB search
MRNCIIAQSGGPTAVINASAVGIYEKNLETKYFDKVYFGINGIEGILNKNIIDSDSLNKD
NVLNLKQTPSSGLGSCRYKLADYKINSYDYDRVINILDEYEIDTLFYIGGNDSMDTVMKF
SQYCKNTTCKIKFIGIPKTIDNDLLGTDNCPGFGSAAKLISTLIMETYLDFSIYKNNGIF
IVETMGRDTGWLAASSSLARLNDTPLVDLIYLPEIDFYEDKFIEDVRKIFKEKNKAYIVA
SEGIRDKYGNFICEQKTSAHDKFGHSQLGGVSNYLKNLIVSSSITTRVKTLELGVIQRCA
MHLASDTDLKQAAEVGAYGIELSKKGYTGVMAIINRTCNNPYKYEVSHTDISKIANKTKY
FPKEWINEECNYITDEALNYLYPLIQGKPDIKYKNGLPYFSIIY
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgagaaactgtattattgcccaatctggaggccctacagctgttatcaatgcttctgca
gttggtatttatgaaaaaaatttagaaactaaatactttgataaagtatattttggtatc
aatgggattgaaggtatattaaacaaaaatataatagattcagactccttaaacaaagat
aatgtattaaatttaaagcaaacaccttcgtctggtcttggttcttgtagatacaaactg
gctgattataaaataaattcttatgattatgatagagttataaatatactagatgaatat
gaaatagatacattattttatataggcggaaatgattctatggacacagtgatgaaattt
tctcaatactgcaaaaacactacttgtaaaataaaatttatagggattcctaaaacaata
gataatgatttattaggaactgacaactgtcctggatttggttctgctgcaaagcttatt
tctacactaataatggaaacatacttagatttttctatatacaaaaataatggtatattt
atagtagaaaccatgggtagagatactggatggttagcagcttcttcttcactagctaga
cttaatgatactccacttgttgatttaatataccttccagaaattgatttctatgaagat
aagtttatagaagatgttagaaaaatatttaaagaaaaaaataaggcttatatagttgca
tcagaaggtataagggataaatacgggaactttatatgcgaacaaaaaacttctgctcat
gataaatttggtcattcccaattaggtggagtaagcaactatctaaagaatcttatagta
tcatcatcaattacaacaagagtaaaaaccttagaacttggtgtaatacaaagatgtgct
atgcatttagcttcagatactgatttaaaacaagcagctgaagttggtgcatatgggata
gaactatctaaaaaaggatatacaggagttatggctatcattaatagaacatgcaataat
ccttataagtatgaagttagtcatactgatatttctaaaatagctaacaagacaaaatat
tttcctaaagagtggataaatgaagaatgtaattatataactgatgaagccctaaattat
ctatatccacttattcaaggtaaaccagatatcaaatataaaaatggactaccttatttt
tcaattatttactag

DBGET integrated database retrieval system