KEGG   Peptoclostridium difficile BI1: CDBI1_15120Help
Entry
CDBI1_15120       CDS       T01779                                 

Definition
6-phospho-beta-glucosidase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
cdg  Peptoclostridium difficile BI1
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:cdg00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CDBI1_15120
Enzymes [BR:cdg01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     CDBI1_15120
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(3456618..3458045)
Genome map
AA seq 475 aa AA seqDB search
MSFKDDFLWGGATAANQCEGGYNEDERGLANVDVCPTGKDRTAVITGKLKMFDFDDEHYY
PAKTGIDMYHNYKEDIKLFAEMGFKVYRMSIAWSRIFPKGDEETPNEKGLQFYENIFKEC
KKYKIEPLVTITHFDCPMHLVKKYGAWRNRKMIGFYEKLCNVIFRRYRGLVKYWLTFNEI
NMILHAPFMGAGICFEEGEDVEKIKYQAAHHELVASAIATKIAHEVDSNNLVGCMFAAGS
VYPYSCNPNDVWEATKLDRENYFFVDVQSKGKYPNYALKYMEQKGITPEMEPGDIELLNK
YTVDFISFSYYNSRCVRTDENADDMAEGNIFTSAKNPYLSYSQWGWPIDPLGLRITLNHV
YDRYEKPLFIVENGLGAKDIADENGYVEDDYRINYLREHIKAMHDAVSIDGVDLLGYTTW
APIDLVSAGTGEMEKRYGFIYVDRDNSGNGSLRRMKKKSFEWYKKVIASNGEDLY
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgagttttaaggatgattttttatggggaggagctactgcagccaatcaatgtgaaggt
ggatacaatgaagacgaaagaggattggcaaatgtagatgtatgtccaacaggaaaagat
agaacagcagttattacagggaaactaaaaatgtttgattttgatgatgagcattattat
ccagctaaaactggtattgatatgtatcataattataaagaagatataaagttatttgct
gaaatgggatttaaagtatatagaatgagcattgcatggagtcgaatatttccaaaaggt
gatgaagaaacaccaaatgaaaagggacttcaattttatgaaaatatatttaaggagtgt
aaaaaatataaaatagagcctttagtcactattacacactttgattgtccaatgcattta
gttaaaaagtatggtgcatggcgtaatcgaaaaatgataggtttctatgagaaattatgc
aatgttatctttagaagatatagaggattagtgaagtactggctaacctttaatgaaata
aatatgattttacatgctccatttatgggtgctggtatttgctttgaagaaggtgaagat
gttgaaaagataaaatatcaagctgctcatcatgagcttgtagctagtgcaattgcaact
aaaatagcacatgaagttgattcaaataacttagttggatgtatgtttgcagctggaagt
gtatatccttatagttgtaatcctaatgatgtatgggaagctacaaagttagatagagaa
aattacttctttgtggatgtacaatctaaaggtaaatatcctaactatgcgttaaagtat
atggagcaaaaaggtattacaccagaaatggaacctggtgatattgaattattgaataaa
tatacagtagattttatttcattttcatattacaatagccgttgtgttagaactgatgaa
aatgcagatgatatggctgaaggaaacatatttacatctgctaaaaatccatatctttca
tacagtcaatggggatggccaattgacccattaggtttgagaattacactaaatcatgta
tatgatagatatgaaaagccactatttattgtagaaaatggattaggtgctaaagatata
gctgatgaaaatggttatgtagaagatgattacagaattaattatctaagagaacatata
aaagctatgcatgatgcagtttctatagatggggtcgatttattaggttatactacatgg
gcacctattgatttagtaagtgctggtacaggtgaaatggaaaagcgttatggatttata
tatgtagatagagataatagtggtaatggaagtctaagaagaatgaaaaagaaaagtttt
gaatggtataagaaagtaattgcttcaaatggtgaagatttatattaa

DBGET integrated database retrieval system