KEGG   Clostridium difficile BI1: CDBI1_16605Help
Entry
CDBI1_16605       CDS       T01779                                 

Definition
delta-aminolevulinic acid dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
cdg  Clostridium difficile BI1
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:cdg00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(3802758..3803723)
Genome map
AA seq 321 aa AA seqDB search
MLRRPRRLRASKAIRNLVRETKVNVEDLIYPLFVVEGENIKEEINSLPDVYHLSIDMLED
EIKEISELGIEHIMLFGVPDEKDECASQAFNDNGIVQKAIRKVKEINSDINVITDVCMCQ
YTSHGHCGILTDTGYVDNDKSLEYLAKISVSHAKAGADMVAPSDMMDGRIQAIREALDEN
GLENVGIMAYSVKYASNYYGPFREAAHSAPSFGDRKTYQMDPANSNEAIIETELDILEGA
DILMVKPALSYLDIIRRVKDNFDLPLAAYNVSGEYSMLKFAVKEGLLNEDVILESITSIK
RAGADIIITYFAKDIAKLLKK
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgttaagaagaccaagaagactaagagcaagtaaagcaatcagaaatttggtaagagaa
actaaggtgaatgtagaagatttaatatatccactgtttgtagtagagggggaaaatata
aaagaagaaatcaattctttaccagatgtatatcatttatcaatagacatgctagaagac
gaaataaaagaaataagtgagttgggaattgaacatataatgttatttggtgttccagat
gaaaaagatgagtgtgcttcacaagcttttaatgataatggaatagttcaaaaggcaatt
agaaaggtaaaagaaataaattcagatataaatgtaataacagatgtctgtatgtgccaa
tatacaagtcatggacattgtgggattttaactgatactggttatgttgataatgataaa
tcattggagtatttggctaaaatatctgtaagccatgctaaagcaggagctgatatggtt
gctccatctgatatgatggatggaagaatacaagcaataagagaagctttagatgaaaat
ggattagaaaatgttggaatcatggcttatagtgttaagtatgcttcaaattattatgga
ccttttagagaggcagctcattcagcaccatcttttggagatagaaaaacatatcaaatg
gacccagcaaatagcaatgaagctataatagagactgaacttgatatattggaaggtgca
gatatacttatggttaaacctgcattatcatatttagatattataagaagagttaaagat
aattttgacttacctctagcagcttataatgtaagtggagaatactctatgcttaagttt
gctgtgaaggaaggtttattaaatgaagatgtaattcttgaatcaattacatctataaaa
agagcaggagcagatataataataacttattttgctaaagacattgctaaactgttgaaa
aaataa

DBGET integrated database retrieval system