KEGG   Corynebacterium diphtheriae INCA 402: CDB402_0303Help
Entry
CDB402_0303       CDS       T01688                                 

Gene name
gpmA
Definition
(RefSeq) phosphoglycerate mutase (EC:5.4.2.1)
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
cdh  Corynebacterium diphtheriae INCA 402
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:cdh00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CDB402_0303 (gpmA)
   01230 Biosynthesis of amino acids
    CDB402_0303 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CDB402_0303 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    CDB402_0303 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CDB402_0303 (gpmA)
Enzymes [BR:cdh01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     CDB402_0303 (gpmA)
Exosome [BR:cdh04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   CDB402_0303 (gpmA)
  Exosomal proteins of melanoma cells
   CDB402_0303 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
323340..324086
Genome map
AA seq 248 aa AA seqDB search
MTTGKLILLRHGQSEWNASNQFTGWVDVNLTEKGEAEAKRGGELLKAQGVLPSVVYTSLL
RRAIRTANIALNAADRHWIPVVRDWRLNERHYGALQGLNKAETKEKYGDEQFMAWRRSYG
TPPPELEDSSEFSQANDPRYANLDVVPRTECLKDVVERFVPYFKEEILPRVKNGETVLIA
AHGNSLRALVKHLDNISDADIAELNIPTGIPLVYELDEAGTVLNPGGTYLDPEAAAAGAA
AVAAQGAK
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgactactggaaaactgattcttcttcgtcacggacaaagcgaatggaacgcttccaac
cagttcaccggctgggtggacgtcaacctcaccgaaaagggcgaggcagaggctaagcgc
ggcggcgagctgctcaaggctcagggtgtcctgccaagcgtggtgtacacctctttgctg
cgccgtgctatccgcaccgccaacattgctctgaacgctgctgatcgccactggatccca
gttgttcgcgattggcgcctcaacgagcgccactacggtgcgctgcagggcctgaacaag
gctgagactaaggaaaagtacggcgacgagcagttcatggcatggcgtcgttcttatggc
accccaccaccagagcttgaggattccagcgagttctcccaggcaaacgatcctcgttac
gccaaccttgacgtggttcctcgcaccgagtgcttgaaggacgttgttgagcgtttcgtt
ccttacttcaaggaagagatcctgccacgtgtgaagaacggtgagactgttttgatcgct
gcacacggtaactccctgcgtgcattggtcaagcacctagacaacatctctgatgcagac
atcgctgagctcaacattcctaccggtattccactggtttatgagctcgacgaggctggc
acggtgctcaacccaggtggcacctaccttgacccagaggctgctgctgccggtgctgcc
gcagttgctgctcagggcgctaagtag

DBGET integrated database retrieval system