KEGG   Corynebacterium diphtheriae INCA 402: CDB402_0316Help
Entry
CDB402_0316       CDS       T01688                                 

Gene name
hemD
Definition
uroporphyrin-III C-methyltransferase / uroporphyrinogen-III synthase
Orthology
K13542  
uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
cdh  Corynebacterium diphtheriae INCA 402
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:cdh00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
334605..336275
Genome map
AA seq 556 aa AA seqDB search
MRLIMKPEHSTRGRVIFVGAGPGNPDLLTVRAREVLGSTANAVVDSTVGVGIRAVIAEHL
EVPQAKLDAAEAEYERMCAAAKRRKPPRPDAPTAAEITEVSADASVDEVMAVLLPLLDEG
DVIRLVQGNPLADSRALDEITAVTQVGADFQIVPGMSLPAAVPAFAGITLGDSYTKTTVS
EDTNWDQLATAPLPLILQASKDDLLTIATELKDRKLPASTPVTVTMNGTTRLQRSFDVTL
KTMKSLVKQELDGTLVVTVGVSDRSTFSWWESRALFGWRVLVPRAKDQAGPMSSRIAAYG
AIAQEVPTISVEPPRNPAQLERAIKGIVEGRYQWVVFTSVNAVKAVREKIVSFGLDSRAF
AGVHIAAVGAKTAAAIREFGITPELIPPRKEHNAAGMVSVFPNYVEGLDPVGRVLLPRAD
IATDVLVDGLVNLGWEVDDVVAYRTVRAAPPSAEVRDMIKSGDFDAVCFTSASTVRNLVG
IAGKPHARTIIACIGPMTAAEAEKQGLRVDVIPEVANVAALVDALAEHVEKLRAAGELPP
PRKKRRARRKSKEGAV
NT seq 1671 nt NT seq  +upstreamnt  +downstreamnt
atgcgattaatcatgaagcccgagcactcaacgcgaggacgtgtcatcttcgtcggcgcc
ggtcccggcaacccagatcttttgacggttcgagcccgcgaggtgctgggctccacagcc
aatgcagtggtggattccactgttggcgtaggtattcgcgcagttattgctgaacatctt
gaggtaccgcaggccaagcttgatgcagctgaggctgagtatgagcgcatgtgtgcggct
gcgaagcgtcgtaagcctccgcgtcccgacgcccccaccgccgcggaaatcactgaggtg
tccgctgatgcgagcgtcgatgaagtgatggcggtgctgttgcctttgctagacgaaggc
gatgtgatccgcctagtgcagggtaacccgttggcggattcccgcgcgttagatgagatt
acggctgttacacaggtgggcgcggatttccagattgtgccaggtatgtcgttgccggct
gcggttcctgctttcgcgggtattacgttgggcgattcttataccaagactacggtgagt
gaggatactaactgggatcagttggcaaccgccccgctgccgttgattttgcaggcgagt
aaagacgacctactgactatcgctacggagttgaaggatcgcaaactgccggcgagcact
ccggtgacggtgacgatgaatggcacgacgcgtttgcagcgcagctttgacgtgacgctt
aaaactatgaagtcgctggtcaaacaggagctcgatggcacccttgtggtcacagtgggt
gtatcggatcgcagtacattttcgtggtgggaaagccgcgcgttgtttggctggcgggtg
ttggttccccgtgcgaaggatcaagctggtccgatgagcagccgaatcgccgcttatggt
gctattgcccaagaggttcccactatttctgtggagccgccgcgtaatccggcgcagttg
gagcgtgcgattaagggcattgtggagggacgctaccagtgggtggtgtttaccagcgtg
aatgctgttaaagcggtgcgtgagaagatcgtgtcgtttggtttggattctcgcgcgttc
gcgggggtgcatatcgctgcggtgggggctaagactgcggcggcgattcgtgagtttggc
attactcctgagctaattccgccacggaaggagcataatgctgcgggtatggtgtcggtt
ttccctaattatgtggagggcttggacccggtaggtcgagtgttgctgccgcgggctgat
attgccactgacgtgctggttgatggtttggtcaaccttggctgggaagttgatgatgtg
gtggcgtatcgtacggtgcgtgccgcgccgccgagtgcggaagtccgcgacatgattaag
tccggcgattttgatgcggtgtgttttacctctgcgtcgacggtgcgcaatttggtgggt
attgcgggtaagccgcatgcgcgcacgatcattgcatgtattgggccgatgaccgccgcg
gaggcagagaagcaagggctgcgtgtcgacgtcatccccgaggtagctaacgttgcggct
cttgtggatgcgctcgcggagcatgtggagaaactgcgtgctgcgggtgagttgccgccg
ccgcgtaagaagcgtcgggcccgtcgcaaatctaaggaaggtgctgtatga

DBGET integrated database retrieval system