KEGG   Corynebacterium diphtheriae INCA 402: CDB402_0322Help
Entry
CDB402_0322       CDS       T01688                                 

Gene name
hemG
Definition
(GenBank) protoporphyrinogen oxidase
  KO
K00231  protoporphyrinogen/coproporphyrinogen III oxidase [EC:1.3.3.4 1.3.3.15]
Organism
cdh  Corynebacterium diphtheriae INCA 402
Pathway
cdh00860  Porphyrin and chlorophyll metabolism
cdh01100  Metabolic pathways
cdh01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cdh00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CDB402_0322 (hemG)
Enzymes [BR:cdh01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     CDB402_0322 (hemG)
    1.3.3.15  coproporphyrinogen III oxidase (coproporphyrin-forming)
     CDB402_0322 (hemG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 DAO FAD_binding_2 Pyr_redox_2 HI0933_like Thi4 Pyr_redox GIDA
Motif
Other DBs
NCBI-ProteinID: AEX45633
Position
342481..343833
Genome map
AA seq 450 aa AA seqDB search
MRIAIIGAGLAGLTAAYRLRDHDVSVFEATDRIGGKLHTVAFQSGPTDMGAEAYLAFRED
TTAFFKELGLEVVSPSGLPSLLYVDGELHPMPMNTVMGIPGSSKGLEKLVSAETAARIDA
ESDSMDWPQEVTLGEVLRERFGDDLVDHVVSALQGGVYSSTSDDLSLRDTVPQLARALDR
LKEEGKPVTITAAVQSIMADREKRNKARGYKPSVFAAFPGGYAELYETLAEKSGAKIHID
AFITGIQWKDGFTLTGAEGTFDKVIVAVPAPTAAMLLKSVAPEASALLKNIKLASSAVVG
MKFDSAEGLPDNSGILVATDAEVTAKAFTFSSKKWPHLGQRGGALVRASFGRFGDDAIAR
ADEDLLVDTALDDLQTITGFDGRAAGLSEIYVQRWFGGLPVYGPGHSDLVAAIKDALPVG
IYATGAWADGVGVPAVIDSATKVAKLLEDH
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
gtgcgtattgcgatcattggtgcggggcttgcgggtttgactgcggcgtatcgtcttcgt
gaccatgatgtttcggttttcgaggcgactgaccgtattggtggcaagctgcatacggtt
gcgtttcagtctggccctacggatatgggtgcagaggcgtatttggcgtttcgtgaggat
acgacggcctttttcaaggagttaggtcttgaggttgtgtcgccttcggggttgccgtcg
ttgttgtatgtcgatggcgagttgcatccgatgccgatgaatacggtgatggggattcca
ggctcgtcgaagggtttggagaagttggtgagtgcggagactgccgcgcgtatcgacgcc
gaatctgattccatggactggccccaggaggtgactctgggggaggttttgcgtgagcgc
tttggcgatgacctcgtggatcacgtggtgtcggcgttgcagggtggtgtgtattcctct
acgtctgatgatctttcgttgcgggatacggttccgcagttggcgcgtgcgttggatcgc
ctgaaagaagaaggcaagccagtgacaattaccgctgcggtgcagtcgattatggctgat
cgtgagaagcgtaataaggcccgtggttataagccgagtgtgtttgcggctttccctggt
ggttatgcggagctgtatgagacgctggcggagaagtcgggtgcgaagatccacattgat
gcctttattactggcattcagtggaaggatgggttcacgctgacgggtgctgagggaacc
tttgacaaggtgattgtggcggttccagctccgacggcggcgatgttgttgaagtctgtg
gcaccggaggcgtcggcgttgctgaaaaacatcaagttggcgagctctgcggtggtgggc
atgaagttcgattccgcggaggggctgccggataattcgggcattttggttgctacggat
gcagaggttactgcgaaggcgtttacattttcttcgaagaagtggccgcatttggggcag
cgcggtggcgcgttggtgcgtgcgtcgtttggccgttttggtgatgatgccattgcgcgt
gccgacgaagacctgctggtggataccgcccttgatgatcttcagactattacgggtttt
gatggccgtgcggctgggctgtcggagatctatgtgcagcgctggttcggtggcttgccg
gtgtacggcccagggcatagcgatcttgtggctgcgattaaggacgcactgccagtaggt
atttatgccaccggcgcttgggccgatggcgtgggtgttcctgcggtgattgattctgca
actaaggtggcaaagttactggaagatcactga

DBGET integrated database retrieval system