KEGG   Corynebacterium diphtheriae INCA 402: CDB402_0429Help
Entry
CDB402_0429       CDS       T01688                                 

Definition
putative regulatory protein sugar kinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
cdh  Corynebacterium diphtheriae INCA 402
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cdh00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CDB402_0429
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CDB402_0429
   00052 Galactose metabolism
    CDB402_0429
   00500 Starch and sucrose metabolism
    CDB402_0429
   00520 Amino sugar and nucleotide sugar metabolism
    CDB402_0429
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    CDB402_0429
   00524 Butirosin and neomycin biosynthesis
    CDB402_0429
Enzymes [BR:cdh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     CDB402_0429
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
451771..452655
Genome map
AA seq 294 aa AA seqDB search
MTHALGVDIGGTKIAVGIVDTTDPTTVISRHIVATPDNDVIDHVRDAIAHIITPEVTSIG
IGAPGVIDETTGVVVSSGPTMQGWAGTRIADTIAAEFSLPVAVHNDVRVMGLGESIYGAG
RDYTNVLFVSLGTGVGGAIVRDGRLVASPHHTAGELRALIGRLPDGRADLLENFAAGPGL
AQRFGERYPEHAGRDLRFIMELYHAGDTHARDYITATLAAAGETIAGFASAIDVDAIIIG
GGVGNIGDAIIKPFAHGFAAHAIPPLDTIPIRQAQLGTDAPIVGAAHLGHSAIE
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgacacacgcactcggtgtcgacatcggcggtaccaaaatcgcagtcggaatcgtagac
accaccgatcccaccaccgtaatcagccgacacattgtagccacacccgacaacgacgtg
atcgaccacgtacgcgacgcgatcgcccacatcatcaccccagaagtaaccagcattggc
atcggcgcgccgggtgttatcgacgaaaccacaggcgtagtcgtctcctccggtcccacc
atgcaaggctgggctggcacacgcatcgcggatactatcgccgcggaattttcgctaccc
gtcgccgtgcataacgacgtccgcgtcatggggctcggcgaatccatctacggcgccgga
cgcgactacaccaacgtactctttgtcagccttgggaccggtgtcggcggcgccattgtt
cgcgacggacgcctcgtagcatccccgcaccacactgcaggcgaacttcgggcactcatc
ggcaggcttcccgacggccgcgcagacctcctagaaaacttcgccgcaggacccggcttg
gcacaaagattcggtgaacgctaccccgaacacgcaggccgtgacctgcgattcatcatg
gagctctaccatgcaggagacacccacgcccgcgactacatcaccgcaacacttgcagca
gcaggcgaaaccatcgcaggattcgccagcgccatcgacgtagacgccatcatcatcggt
ggcggagtaggcaacatcggcgacgccatcatcaaaccatttgcccacggattcgcagcc
cacgccattccaccgctggacacgatccccatccggcaagcacaacttggcaccgacgca
ccgatcgtcggcgcagcacaccttggccacagcgccatcgaataa

DBGET integrated database retrieval system