KEGG   Corynebacterium diphtheriae INCA 402: CDB402_0570Help
Entry
CDB402_0570       CDS       T01688                                 

Gene name
rbsK
Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
cdh  Corynebacterium diphtheriae INCA 402
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:cdh00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    CDB402_0570 (rbsK)
Enzymes [BR:cdh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     CDB402_0570 (rbsK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(594131..595036)
Genome map
AA seq 301 aa AA seqDB search
MSSSMTVVGSINADVSIQVARHPSPGETVLGHDSTISPGGKGANQAVAAALQGASVSFVG
AVGNDTYADHALKILRSSGVNLDAVETIDDNTGVAYIQVSDDGENSIIVIPGANAHVTAD
YVEHHRKPIEDADIVLLQGEIPADGFSAAVQAARGTVVVNLAPVIDVDRDCLLRADPLMA
NEHEAALILEQLGAPVTSEDPRVLIEALRSQGFASVVLTLGGHGALVADASGVTPIATPY
VTAVDTTGAGDAFAGAFVARRLQGDSLIDAATFAARVGAFSVQGRGAQTSYPSESDTLPA
V
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgtcctcatctatgactgttgttggttcgatcaacgctgacgtcagcatccaagtagca
cgacatcccagcccaggtgaaaccgtcctaggccacgactccaccatcagccccggcggc
aaaggcgcaaaccaagccgttgccgctgcgctccaaggcgcatcagtatctttcgtaggc
gcagtaggaaacgacacctatgccgaccacgcactaaaaatcctgcgatcttccggcgtg
aacttagacgcagtcgaaacaatcgacgacaacaccggcgttgcgtacattcaagtctcc
gacgatggcgaaaacagcatcatcgttattcccggcgcgaacgcgcatgtcaccgcggac
tacgtagagcaccatcgtaaacccattgaggacgccgacatcgtgctcttacagggtgag
attcccgcggatggttttagcgccgcagtgcaagcagctcgaggcaccgtggtagtcaat
cttgcgcctgtgattgatgtcgatcgtgactgtctcctacgcgcggatccgttgatggct
aatgagcatgaggcggcgttgattctagagcaactcggcgctccggtaaccagtgaagat
ccccgcgttctgatcgaggcactgcgttcgcaagggtttgcctccgtggtgttgaccctt
ggtggacatggcgcgctggtcgccgatgcttctggtgtgacgccgattgccaccccatac
gtcacagcagtagacaccacgggtgctggtgacgcattcgcgggggctttcgtggcacgt
cgtttgcaaggagactcgcttatcgacgccgccacgttcgcagcccgtgtcggagcgttc
tccgttcaaggtcgcggggcgcaaacttcttatccttctgagtccgatacgctgcccgcg
gtgtag

DBGET integrated database retrieval system