KEGG   Corynebacterium diphtheriae INCA 402: CDB402_0713Help
Entry
CDB402_0713       CDS       T01688                                 

Gene name
cysQ
Definition
inositol monophosphate phosphatase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
cdh  Corynebacterium diphtheriae INCA 402
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:cdh00920]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(744542..745300)
Genome map
AA seq 252 aa AA seqDB search
MTAQFDDATLTKRLAKGTGEILKGVRNVGLLRGRELGEAGDDLAQNWIARVLEQHRPDDG
FLSEEAADNPERLGKDRVWIIDPLDGTKEFATGRQDWAVHIALVENGVPTHAAVNLPDLG
VVFHSSEVRAVGGPYAKKIAISHNRPPAVATHIAESLGFTAEPMGSAGAKAMHVLLGDYD
AYIHAGGQYEWDSAAPVGVSLAAGLHCSRLDGTPLNYNNKDTYLPDVLICRPELADDILT
MAAAFREENGSY
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgactgctcagtttgacgatgcaacacttaccaagcgactagccaaaggcacaggcgag
atcctcaaaggagtgcgcaacgtgggtcttctccgcggacgcgaactcggcgaagccggc
gacgatctcgcacaaaactggatcgcccgcgtactcgagcagcaccgccccgacgacggc
ttcctctccgaagaagcagccgataacccagaacgcctcggcaaagatcgcgtatggatt
atcgaccccctcgatggcaccaaagaatttgccaccggccgccaggactgggctgttcac
atcgcgcttgtagaaaacggcgtacccacccacgctgccgttaaccttcccgaccttggc
gtggtattccactcctccgaggttcgcgcagtaggcggcccctacgccaagaagatcgct
atctctcacaaccgcccaccagcggtagccacccacatcgcggaatccttaggcttcacc
gcagaacccatgggatccgctggtgcaaaggccatgcacgtactgttgggcgactacgat
gcctacatccacgcaggtggacagtacgagtgggactccgcggccccagtgggcgtgagc
ctcgccgcaggtctgcactgctcgcgtctcgacggcaccccgttgaactacaacaacaaa
gacacgtatcttccagacgtactgatctgccgccccgagcttgccgacgacatcctcacc
atggccgcagctttccgtgaggagaacggctcctactaa

DBGET integrated database retrieval system