KEGG   Corynebacterium diphtheriae INCA 402: CDB402_1009Help
Entry
CDB402_1009       CDS       T01688                                 

Gene name
ung
Definition
uracil-DNA glycosylase (EC:3.2.2.-)
Orthology
K03648  
uracil-DNA glycosylase [EC:3.2.2.27]
Organism
cdh  Corynebacterium diphtheriae INCA 402
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:cdh03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1063569..1064237
Genome map
AA seq 222 aa AA seqDB search
MNNTPLPVHPSWIEPLAPVTDNIHAMGDFLRNEIAQGRGYLPAGSDILRAFQYPFDDIKV
LIVGQDPYPTPGHAMGLSFSTQPGVRPLPRSLANIFKELSADLGIPAPTDGDLTAWSRQG
VALFNRVLSVQPGNAGSHRKKGWEIITETAIRALAQRNTPLVAILWGKDAQTTQAFLGNT
PVITSPHPSPLSASRGFFGSRPFSRANTILEQLGITPINWEL
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgaacaacacaccactgccagttcatccctcatggatagaaccactagcgcccgtgact
gacaacattcacgccatgggagacttcctccgcaatgaaatcgcccaaggccgtggctac
ttgcccgcaggatcagacatcctccgcgcattccaatacccattcgacgacatcaaagtg
ctcatcgttggccaagatccctacccaacaccagggcacgccatgggcctatccttttcc
acacaacccggcgtacgcccactgccacgcagcctagccaacattttcaaagaactgtcc
gccgacctcggcatcccagcccccacagacggcgacctcaccgcatggtcgcgacaaggc
gtggcactgttcaacagagtccttagcgttcaacccggaaacgctggctctcaccgcaaa
aaaggatgggaaataatcacagaaaccgccatccgagcactcgcacaacgcaacacacca
ctcgtagcaatcctgtggggcaaagacgcccaaacaacccaagcattcctcggcaacacc
cccgtcatcacctcaccacacccctcaccactatcagcatcccgtggtttcttcggctct
cgcccctttagccgagccaacaccatcctcgaacaactaggcatcacccccatcaactgg
gaactataa

DBGET integrated database retrieval system