KEGG   Corynebacterium diphtheriae INCA 402: CDB402_1400Help
Entry
CDB402_1400       CDS       T01688                                 

Gene name
chlI2
Definition
magnesium chelatase subunit D (EC:6.6.1.1)
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
cdh  Corynebacterium diphtheriae INCA 402
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cdh00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CDB402_1400 (chlI2)
Enzymes [BR:cdh01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     CDB402_1400 (chlI2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1520714..1521799)
Genome map
AA seq 361 aa AA seqDB search
MSTKQSPLFPFSAVVGQDQLRLALILTAISPRIGGVVIRGEKGTAKTTTVRAFAALLGDA
PLVNLPIGATEDRVVGSLDMETVLTTGKAKFRPGLLSQAHGGVLYVDEVNLLADHLVDAL
LDAAATGQVTVERDGISHTAPARFVLVGTMNPEEGELRPQLLDRFGLSVDVAASKDVQIR
AEIMRRRLDFESDPIDFAQRWHALDENTSQAIKSAQERVDSIVLSDTNLARIAHICASFD
VDGMRADLVIARTAIAHAAWRGDSLVTDEDIKVAAELALPHRRRRDPFDEPGLDQDQLDE
VMDEARDQHPEMDDPAEQSAHEDQIENETSDQEDHLDDQETQTPDSDGQEGSASQGAPFR
P
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgtcaacgaagcagtctccgctttttcctttttctgccgttgtaggccaagatcaactg
cgactcgcgttaattcttacggcgatttcaccacgaattggtggcgtagtaatccgcggt
gaaaagggaaccgcaaaaacgacgacggttcgtgcctttgcagcgttgctaggtgatgcg
ccactggtcaatcttcccatcggagcaacggaagatcgcgttgttggctcgttagatatg
gagactgtgctaacaacaggaaaagctaagtttcgcccgggcttgctgtcccaagcgcat
ggtggtgttttgtacgtcgatgaggtcaacttgttggctgatcatctcgttgatgcgctt
cttgatgcggccgcgactgggcaggtgactgttgaacgtgatggtatttcgcatacagct
cctgctcgttttgtgctcgtaggaaccatgaatccagaagaaggggaattgcggcctcag
ctgctcgatcgttttggactttctgtagatgtagcagcatcgaaggatgttcagattcga
gcagaaattatgcgcagaagactcgattttgaatctgatcccattgactttgcacaacgc
tggcatgcactagacgagaacacgtcgcaagcaatcaagagcgcgcaagaacgtgtcgat
agcattgtgctcagtgatacaaatttggcacgtatcgctcatatttgtgcttcttttgac
gttgatggcatgcgtgctgatctcgttattgctcgtactgctattgcccatgctgcatgg
cgcggtgattcgctggtgactgacgaggacatcaaagtagcagcagaacttgctctgcca
catcgacgtcgtagggatccgtttgatgaacccggccttgatcaagaccaacttgatgaa
gttatggatgaagcacgtgaccagcacccagagatggatgatcctgctgaacaatcagca
catgaggatcaaatagaaaacgaaacttctgatcaagaagatcatctagacgatcaagaa
actcagactcctgattccgatggtcaggagggcagcgcttctcaaggcgccccctttcgt
ccctaa

DBGET integrated database retrieval system