KEGG   Corynebacterium diphtheriae INCA 402: CDB402_1523Help
Entry
CDB402_1523       CDS       T01688                                 

Gene name
glk
Definition
(GenBank) glucose kinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
cdh  Corynebacterium diphtheriae INCA 402
Pathway
cdh00010  Glycolysis / Gluconeogenesis
cdh00052  Galactose metabolism
cdh00500  Starch and sucrose metabolism
cdh00520  Amino sugar and nucleotide sugar metabolism
cdh00521  Streptomycin biosynthesis
cdh01100  Metabolic pathways
cdh01110  Biosynthesis of secondary metabolites
cdh01120  Microbial metabolism in diverse environments
cdh01130  Biosynthesis of antibiotics
cdh01200  Carbon metabolism
Module
cdh_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cdh00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CDB402_1523 (glk)
   00052 Galactose metabolism
    CDB402_1523 (glk)
   00500 Starch and sucrose metabolism
    CDB402_1523 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    CDB402_1523 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    CDB402_1523 (glk)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    CDB402_1523 (glk)
Enzymes [BR:cdh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     CDB402_1523 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK Glucokinase TCR Hydant_A_N
Motif
Other DBs
NCBI-ProteinID: AEX46820
Position
complement(1660303..1661256)
Genome map
AA seq 317 aa AA seqDB search
MTNMSESVTVGFDIGGTNMRAAAVTDSGLIIDSVSVPTPKSSEALEKGIISLVAQLREKH
EVSAVGLAVAGFLDPDCEIVRFAPHLPWRDRPVRAELEDALGLPVRLEHDANSAAWGEYR
FGAARGSQNWVLFAVGTGIGATLMHEGEIYRGAFGTAPEFGHLTVVPQGRQCSCGKSGCL
ERYCSGTAIEATARELLDADRGRDSMVAAAYHSGTLSGKTVTEAARQGDVFAIEVFDDFA
EWMGRALSIVCDVLDPGQIVIGGGLSTSSDLFLEKATQHMAQQIVGAGYRPLPTVVCAEL
GGDAGMIGVSDLARRRV
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgacgaatatgtcagaatctgtcactgtcggattcgacatcggtggaaccaatatgcga
gcagcggcggtgacggattccggtttgatcatcgactccgtttcggttcctacccctaaa
tcttctgaggctctggaaaaaggcattatttctctggtagctcaattgcgggaaaagcat
gaggtttcggctgtaggtcttgccgttgcaggttttttggatcctgattgcgaaatcgtt
cgctttgctcctcatctgccgtggcgtgatcgcccagtgcgtgcggaattagaggacgcg
ttgggacttcctgttcgtcttgaacatgatgcgaattctgcagcgtggggagaataccgc
ttcggagcggcacgtggttcgcaaaactgggtcttatttgcggttggcactggtatcggt
gccacactgatgcacgagggtgagatctaccgtggtgcttttggtacagctcctgagttc
ggccaccttaccgttgtccctcaaggtcggcagtgttcttgtggcaagagtggctgtttg
gaacgttattgttccggcactgctattgaagcgacagcgcgtgagcttctcgacgccgat
cgtggccgcgactcgatggttgctgctgcctatcattcgggcacattgagtgggaaaact
gtgaccgaagcggcccgccagggtgatgtttttgccatcgaggtctttgatgattttgct
gaatggatgggccgcgccttgtctatcgtgtgtgatgttttagatccgggacagatcgtg
attggtggcgggttgtccacgtcaagcgatttgttcttggaaaaggctactcagcacatg
gcacagcagattgtcggggctgggtatcgcccccttccgacggtggtgtgtgccgaattg
ggtggcgatgccggtatgatcggggtatctgatctggctcggcgtcgcgtctag

DBGET integrated database retrieval system