KEGG   Corynebacterium diphtheriae INCA 402: CDB402_1705Help
Entry
CDB402_1705       CDS       T01688                                 

Definition
hypothetical protein
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
cdh  Corynebacterium diphtheriae INCA 402
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cdh00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    CDB402_1705
Enzymes [BR:cdh01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     CDB402_1705
    3.5.1.-  
     CDB402_1705
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1859430..1859879
Genome map
AA seq 149 aa AA seqDB search
MNALLIIDIHANSPAPEATEITHAIALHLGQHRGDYSHVIVALQGTIADELAGTTFGNQF
IKDPATQALSAFERTDATGTKLGDWLRANNIDRLDVVGLGTELGIRSSVLDALAQGFDVH
VHKKLCAAVSHDNARAAYNEMDMCGALFE
NT seq 450 nt NT seq  +upstreamnt  +downstreamnt
atgaatgcacttcttattatcgatatccacgccaactcccctgcccccgaggccaccgag
atcacccacgccatcgccctacatctcggccagcaccgcggcgactactcccacgtcatc
gtagctcttcaaggcactatcgccgatgagctagccggtactacctttggcaatcaattc
attaaagaccccgccacccaggccttatccgcttttgagcgcacagatgccaccggcacc
aaactcggcgactggctccgtgccaacaacatagatcgcctcgacgttgtaggccttggc
accgaactcggcattcgctccagcgtgttagacgcactcgcccaaggatttgatgtgcac
gtgcacaaaaaactctgcgctgccgtatcacacgacaacgcccgcgctgcctataacgaa
atggacatgtgcggggcgttattcgaataa

DBGET integrated database retrieval system