KEGG   Corynebacterium diphtheriae INCA 402: CDB402_1792Help
Entry
CDB402_1792       CDS       T01688                                 

Gene name
gpx
Definition
Glutathione peroxidase (EC:1.11.1.9)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
cdh  Corynebacterium diphtheriae INCA 402
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:cdh00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    CDB402_1792 (gpx)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    CDB402_1792 (gpx)
Enzymes [BR:cdh01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     CDB402_1792 (gpx)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1953672..1954142)
Genome map
AA seq 156 aa AA seqDB search
MSIFDTEVTLINGEKASMDQWAGHCLLIVNTASECGYTPQLETLEELYEDYAMRGFFVIG
VPCNQFGEEEPGKDAQVARRYEEKFGVRFPLLAKSDVNGHNTIELYKKLKGDGPDIEWNF
EKFIVAPSGEVVGRFAPSLDPDDMKIINVLEEYLPI
NT seq 471 nt NT seq  +upstreamnt  +downstreamnt
atgagtatttttgataccgaggtcacgctgatcaacggcgagaaagcctcaatggatcag
tgggctggtcattgcctgttgattgtgaatacggcatcagagtgcggctataccccgcag
ctggagacgctggaagagctttatgaggattatgcgatgcgtggtttcttcgtgatcggt
gttccgtgtaaccagttcggggaggaagaacctggcaaggatgctcaggtggcgcgtcga
tacgaagaaaagtttggggtgcgcttcccgctgttggctaagtcggacgtcaatggccac
aacactattgagctgtataagaagctcaagggtgatggcccagatattgagtggaacttt
gaaaagtttatcgtagcgcccagcggtgaggtggtaggccgctttgcgccctcgcttgat
cctgacgatatgaagatcattaacgtcttagaagagtatcttcctatctaa

DBGET integrated database retrieval system