KEGG   Corynebacterium diphtheriae INCA 402: CDB402_1987Help
Entry
CDB402_1987       CDS       T01688                                 

Definition
(GenBank) hypothetical protein
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
cdh  Corynebacterium diphtheriae INCA 402
Pathway
cdh00071  Fatty acid degradation
cdh00280  Valine, leucine and isoleucine degradation
cdh00310  Lysine degradation
cdh00362  Benzoate degradation
cdh00380  Tryptophan metabolism
cdh00620  Pyruvate metabolism
cdh00630  Glyoxylate and dicarboxylate metabolism
cdh00640  Propanoate metabolism
cdh00650  Butanoate metabolism
cdh00900  Terpenoid backbone biosynthesis
cdh01100  Metabolic pathways
cdh01110  Biosynthesis of secondary metabolites
cdh01120  Microbial metabolism in diverse environments
cdh01130  Biosynthesis of antibiotics
cdh01200  Carbon metabolism
cdh01212  Fatty acid metabolism
cdh02020  Two-component system
Brite
KEGG Orthology (KO) [BR:cdh00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    CDB402_1987
   00630 Glyoxylate and dicarboxylate metabolism
    CDB402_1987
   00640 Propanoate metabolism
    CDB402_1987
   00650 Butanoate metabolism
    CDB402_1987
  Lipid metabolism
   00071 Fatty acid degradation
    CDB402_1987
   00072 Synthesis and degradation of ketone bodies
    CDB402_1987
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CDB402_1987
   00310 Lysine degradation
    CDB402_1987
   00380 Tryptophan metabolism
    CDB402_1987
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CDB402_1987
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CDB402_1987
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    CDB402_1987
Enzymes [BR:cdh01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     CDB402_1987
Exosome [BR:cdh04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CDB402_1987
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AEX47283
Position
complement(2154653..2154862)
Genome map
AA seq 69 aa AA seqDB search
MNRSFDRSPPYHTGGVQINRFCAAGLSAINLAAQKVRSGMDELVLAGGVESMSRVPMMSD
GGALPCSRS
NT seq 210 nt NT seq  +upstreamnt  +downstreamnt
gtgaaccgcagctttgaccgctcgccgccttaccacaccggcggcgtgcagattaaccgt
ttctgcgccgccggcctgtccgccatcaacctagcagctcaaaaggtccgctctggcatg
gacgaacttgttctcgccggcggcgtggagtccatgtcccgcgtaccaatgatgtccgat
ggcggtgctctcccatgctcgcgcagctaa

DBGET integrated database retrieval system