KEGG   Corynebacterium diphtheriae INCA 402: CDB402_1987Help
Entry
CDB402_1987       CDS       T01688                                 

Definition
(GenBank) hypothetical protein
Organism
cdh  Corynebacterium diphtheriae INCA 402
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(2154653..2154862)
Genome map
AA seq 69 aa AA seqDB search
MNRSFDRSPPYHTGGVQINRFCAAGLSAINLAAQKVRSGMDELVLAGGVESMSRVPMMSD
GGALPCSRS
NT seq 210 nt NT seq  +upstreamnt  +downstreamnt
gtgaaccgcagctttgaccgctcgccgccttaccacaccggcggcgtgcagattaaccgt
ttctgcgccgccggcctgtccgccatcaacctagcagctcaaaaggtccgctctggcatg
gacgaacttgttctcgccggcggcgtggagtccatgtcccgcgtaccaatgatgtccgat
ggcggtgctctcccatgctcgcgcagctaa

DBGET integrated database retrieval system