KEGG   Corynebacterium diphtheriae INCA 402: CDB402_1999Help
Entry
CDB402_1999       CDS       T01688                                 

Gene name
alaT
Definition
alanine aminotransferase (EC:2.6.1.2)
Orthology
K14260  
alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
cdh  Corynebacterium diphtheriae INCA 402
Pathway
Alanine, aspartate and glutamate metabolism
Valine, leucine and isoleucine biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Class
Metabolism; Overview; 2-Oxocarboxylic acid metabolism [PATH:cdh01210]
Metabolism; Overview; Biosynthesis of amino acids [PATH:cdh01230]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:cdh00250]
Metabolism; Amino acid metabolism; Valine, leucine and isoleucine biosynthesis [PATH:cdh00290]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2167199..2168470
Genome map
AA seq 423 aa AA seqDB search
MNNKKETPQAAPAQRKRTRRIFDQSDKLKNVLYEIRGPVTAEAEAMELDGHRILKLNTGN
PAIFGFEAPDVIMRDMIASLPTSQGYSTSKGIIPARRAIVTRYEVIPGFPAFDVDDVYIG
NGVSELITMTTQALLNNGDEVLIPMPDYPLWTAATSLAGGKPVHYLCDEEDDWNPSIEDI
KSKITERTKAIVVINPNNPTGAVYSKEVLQKIVDVAREHDLLILADEIYDRILYDGAVHT
NIAALAPDLLCITFNGLSKAYRVAGYRAGWMIVTGPKNNARGFIEGLDLLSGTRLCANVP
GQHAIQVALGGRQSIYDLTGQGGRLLEQRNVTWEKLNAIPGVSCVKPMGALYAFPKLDLE
YYDIKDDAQLMLDLLRQEKILMVQGTGFNWDKPDHFRVVTLPWASQLSEAMDRLGNFLAS
YKQ
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atgaataacaaaaaagagactccacaagcagcccctgcccaacgcaagcgcacacggcgg
atatttgatcagtcggacaagttgaaaaatgtgctgtatgaaatccgtgggccggtgacg
gctgaagcagaggccatggagctcgacgggcaccggattctcaagctcaacacaggcaac
cctgcgatctttgggttcgaggcccctgatgtgatcatgcgtgacatgattgcgtccttg
cctacgtcgcaaggctattccacgtcgaaaggcatcattccggcacgtcgtgcgatcgta
acacgctacgaggtcattccaggttttcctgcttttgacgtagatgatgtttacatcggc
aatggtgtatccgagctgattaccatgaccacccaagcgttgctgaacaacggcgacgaa
gtgctcattccgatgccggattatccgctgtggactgcggcgacgtctcttgcgggcggc
aaaccggtgcactatctgtgcgatgaggaagacgattggaacccgtcgatcgaagacatc
aagtccaagatcaccgagcgcaccaaagccattgtggtgattaaccctaataaccccacc
ggtgcggtgtattccaaggaagtcttgcaaaagatcgttgatgttgcccgtgagcatgat
ctgctgattttggccgatgagatctacgatcgcattctttacgatggcgccgtgcacacc
aacatcgcagctcttgcacctgatcttttgtgcatcactttcaatggtttgtctaaggct
tatcgtgtggcgggttatcgtgccggctggatgatcgtcaccggcccgaagaataatgcc
cgcggttttatcgagggcctcgatttgctgtcgggcacccgtctctgcgctaatgtgcca
ggccagcacgcaatccaggtggcgttgggtggccgccagtcgatttacgatctcacaggt
caaggtggccgtttgctggagcagcgcaatgtgacgtgggagaagctcaacgctattcct
ggcgttagctgcgtgaagccgatgggtgcgttgtatgccttcccgaagctcgacttggag
tactacgacatcaaggatgatgcccagctgatgcttgatttgctgcgccaggaaaagatc
ttgatggtgcagggcacgggctttaactgggataagccggatcatttccgtgtggttacg
ttgccatgggcttcacagttgtcggaggccatggaccggttgggtaacttcctagccagc
tacaagcagtaa

DBGET integrated database retrieval system