KEGG   Corynebacterium diphtheriae INCA 402: CDB402_2034Help
Entry
CDB402_2034       CDS       T01688                                 

Definition
putative secreted glycosyl hydrolase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
cdh  Corynebacterium diphtheriae INCA 402
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cdh00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    CDB402_2034
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    CDB402_2034
Enzymes [BR:cdh01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     CDB402_2034
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2202495..2203661)
Genome map
AA seq 388 aa AA seqDB search
MDNLRRVFTPASLILGTVVAAIMLSSCSQDSSQQAAPSTPSSSTAAASQSEQPSSAMSAT
SSTPQAVALDPVQLRKDAASLMMVGVGNFDDALFAIQQGAGGIFIGSGTDPQILTTPGRD
IAELRRIAGRPLSVAIDFEGGRVLRHRGILGDFPSPQVMAQTMTPEQVRGMAYDMGRSLF
AHGINVNFAPVVDIEAGLEVVGDRAFSPDPLIDATYATAFAQGMADAGVRPVLKHFPGHG
RASGDSHTAQVHTPPLAELEKLDLIPYGRVPVAGAGVMVGHMIVPGLGAPETPSTINPAA
YQLLRSGSYPGGQPFSGVIYTDDLTMGAVTSLMPTVQAVPAALAAGADQALWVSTAGLVE
AIDATVAAVSEGRYPVEQFKASVARVAG
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atggataacctacgccgcgttttcacacccgcctcgctgattcttggcaccgttgttgcc
gctatcatgctgagctcctgctcgcaggactcctcccaacaggctgcgccaagcactccc
tcatcatctactgctgctgcgtcgcagtctgagcagccctcgtcggcaatgtcggcaacg
tcgtcaacgccgcaggctgttgctttagacccagtgcagctgcgcaaagatgctgccagc
ttgatgatggtgggcgtgggcaatttcgacgatgccctctttgccatccagcaaggtgcc
ggcggcatttttatcggctcgggaacggatccccagatcttgaccaccccaggccgcgac
attgcggagctgcgtcgaatagcagggcgcccgctgtctgtagccatcgactttgagggt
ggtcgcgtgttgcgtcaccgcgggatccttggcgatttcccatccccgcaggtgatggcg
caaaccatgaccccagagcaggtgcgcggaatggcttatgacatgggtcgttccttgttc
gcacatggcattaatgtgaactttgcgccggtggtcgatattgaagccggccttgaagta
gtaggcgatcgcgcgtttagcccagatccgcttatcgacgccacctacgccaccgcattc
gcccaaggcatggcggatgctggggtgcgtcccgtgctcaagcacttcccagggcatggt
cgcgccagcggtgactcgcacaccgcacaagtacacaccccaccattggctgagttagaa
aagctcgatctgatcccttatggccgagtgccggttgctggtgcgggcgtgatggttggg
cacatgatcgtgccaggtttgggtgcgccagaaactccgtcgacgatcaaccctgccgca
tatcagttgcttcgttccggttcgtatcccggtggtcaaccttttagtggcgtgatttac
accgatgatttgaccatgggtgcggttacatcattaatgcccactgtgcaggcggtacca
gcagctctagcagcgggtgctgatcaggcactgtgggtaagtacagcgggcttggtcgaa
gccattgatgccactgtggctgcagtctcggaggggcgttaccccgtcgaacagttcaag
gcttcagttgcgcgagtcgcaggctaa

  All links  
No link information was found.   
DBGET integrated database retrieval system