KEGG   Corynebacterium diphtheriae INCA 402: CDB402_2213Help
Entry
CDB402_2213       CDS       T01688                                 

Gene name
trpC1
Definition
(GenBank) indole-3-glycerol phosphate synthase
  KO
K13498  indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.1.48 5.3.1.24]
Organism
cdh  Corynebacterium diphtheriae INCA 402
Pathway
cdh00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cdh01100  Metabolic pathways
cdh01110  Biosynthesis of secondary metabolites
cdh01130  Biosynthesis of antibiotics
cdh01230  Biosynthesis of amino acids
Module
cdh_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cdh00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CDB402_2213 (trpC1)
Enzymes [BR:cdh01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     CDB402_2213 (trpC1)
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.24  phosphoribosylanthranilate isomerase
     CDB402_2213 (trpC1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS PRAI
Motif
Other DBs
NCBI-ProteinID: AEX47502
Position
2421744..2423201
Genome map
AA seq 485 aa AA seqDB search
MQNDSSTSPMPTVLESIVSGRRSHLPEIQARISHVDPARLLRSTRSLFQSLGGRSDGGPA
LRGSARFIMECKSSSPSLGMIREDYRPGDIARVYSRYAAGISVLCEPDRFGGDYNHLATV
AAATHLPVLCKDFIIHPVQVHAARYFGADAILLMLSVLDDATYTELSQEAARLGLDVLTE
VINEVEVERAIRLGATIFGINHRNLHDLSIDLNRSARLAPLIPDSAVIVSESGIRDNETV
RQLSGHSSAFLVGSQLTSQPDVDRAARELVYGHNKVCGLQSPSEAQAARASGAIYGGLIF
EESSPRNVSRETSKKIMAAEPELTYVAVSRRTTGWAEIIGDNIAVAQIHSPYQGSIAAEK
ELINHVRGEVGDKVKIWRAVSMTHADGSLVAEALAPEVDRLVLDTGNGGTGTAFDWARIP
ESVKSKALLAGGIGPDNITEALVVGCAGLDLNSGLEYPAEAGKWATHKDAAAIHSTFTQI
RGFHY
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgcagaatgattcgtcgacaagccccatgcccaccgtcctagaatccatcgtttcgggc
cgacgatcccacctgcccgaaatccaggcgcggatttctcacgtggacccggcgcgacta
ctgcgttccacccgctcgctgtttcagtcgttgggaggccgtagcgatggcggtccggcg
ttgcgggggagtgcgcgcttcatcatggagtgtaagtcctcttcgccgtcgcttggcatg
attcgtgaggattatcgccctggcgacatcgcgcgggtgtattcacgttatgcggccggc
atttcggtgttgtgcgagccggatcgttttggtggcgactacaaccatctggccacggtg
gcggctgccacgcatcttccagtgttatgcaaggattttattatccaccctgtgcaggtt
cacgcggcccgttattttggggcggacgcaattttgctcatgttgagtgtgcttgacgac
gccacctacaccgagctcagccaggaagcagcacgcttggggttggatgttctcaccgag
gttatcaacgaggttgaggtggaacgtgccattcggttgggggctacaatctttggcatt
aatcatcgcaatctgcatgacttgagcattgatttgaatcgctcagcacgtcttgcgcca
ctgattcccgatagcgcagtgattgtctccgagtctggcattcgggacaacgagacggtt
cgccaactcagcgggcattccagtgcgttcctcgtaggctcgcagcttacttctcagcca
gatgtggaccgcgcggcccgtgagcttgtgtacggccacaataaggtgtgcggtttgcag
tcgccaagcgaggcgcaagcagcgcgcgcatcgggtgcaatctatggcggattgatcttc
gaggagtctagtccgcgtaatgtttcacgtgaaacatcgaaaaaaatcatggctgccgaa
cccgaacttacctatgtcgccgtctcacgacgcaccaccggatgggccgaaatcataggt
gacaacatcgccgttgctcagattcacagtccttaccagggctccatcgccgccgaaaaa
gaactcattaaccatgtgcgcggcgaggtaggagacaaggtaaaaatctggcgtgcggtc
tccatgacgcatgccgacggctcccttgtcgccgaggcgctcgcacccgaggtagacaga
ctcgtcctcgacaccggcaatggcggaaccggcaccgccttcgattgggcacgcatccca
gaatccgtgaagagcaaggctcttctcgccggcggcattggaccagacaatatcaccgag
gcgctcgtcgttggctgcgcaggactcgatctcaactccgggttggaatatccagccgaa
gcggggaagtgggcaacacacaaagacgctgctgcaatccactccactttcacccaaata
cgtgggtttcattactaa

DBGET integrated database retrieval system