KEGG   Corynebacterium diphtheriae NCTC 13129: DIP0261Help
Entry
DIP0261           CDS       T00151                                 

Gene name
recR
Definition
(RefSeq) recombination protein RecR
  KO
K06187  
recombination protein RecR
Organism
cdi  Corynebacterium diphtheriae NCTC 13129
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:cdi00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    DIP0261 (recR)
DNA repair and recombination proteins [BR:cdi03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      DIP0261 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
223919..224575
Genome map
AA seq 218 aa AA seqDB search
MFEGPLQDLIDEFSRLPGVGPKSAQRIAFHLLHVEPADITRLQDALGAIRDGVTFCRICC
NISREEVCRICADSSRDRSTICVVEEPKDIQVIERTGEYTGRYHVLGGSLDPLANIGPRE
LNISQLLQRIGGVLPDRELADSTPETPLYDASPEVREVILATDPNTEGEATASYLARLLR
DFPDLVVSRLASGMPLGGDLEFVDELTLSRALSGRLTL
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
ttgttcgaaggacctctccaagacctgatcgacgagttttctcggctccctggtgtgggg
ccgaagtcggctcagcgcattgctttccacctgctccatgtggaaccagcagacattacg
cgtctgcaagatgcgctgggtgctattcgtgacggtgttactttctgccgcatttgctgc
aatatctctcgcgaagaggtctgccgcatttgtgcggactcttcacgcgaccgcagcacc
atctgtgtggtggaagaacccaaagacattcaggttattgaacgaaccggcgagtacaca
ggtcgctaccatgtgctcggcggctcgcttgacccccttgccaacattggcccccgtgag
ctcaacatttcgcaattattgcagcgtatcggcggcgtgttgccagaccgcgaacttgcg
gactccacccccgagacaccgctttacgacgcctccccagaagtgcgcgaggttatcctc
gccaccgaccccaacaccgaaggcgaagccacagcctcctacctagcgcggctgctgcgc
gacttcccagaccttgtggtgtcacgccttgcctctggcatgccactcggcggcgacttg
gagttcgttgacgaacttacactgtcgcgtgcgctgagcggcagactgacgctgtag

DBGET integrated database retrieval system