KEGG   Corynebacterium diphtheriae NCTC 13129: DIP0261Help
Entry
DIP0261           CDS       T00151                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
cdi  Corynebacterium diphtheriae NCTC 13129
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:cdi00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    DIP0261 (recR)
DNA repair and recombination proteins [BR:cdi03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      DIP0261 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
223919..224575
Genome map
AA seq 218 aa AA seqDB search
MFEGPLQDLIDEFSRLPGVGPKSAQRIAFHLLHVEPADITRLQDALGAIRDGVTFCRICC
NISREEVCRICADSSRDRSTICVVEEPKDIQVIERTGEYTGRYHVLGGSLDPLANIGPRE
LNISQLLQRIGGVLPDRELADSTPETPLYDASPEVREVILATDPNTEGEATASYLARLLR
DFPDLVVSRLASGMPLGGDLEFVDELTLSRALSGRLTL
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
ttgttcgaaggacctctccaagacctgatcgacgagttttctcggctccctggtgtgggg
ccgaagtcggctcagcgcattgctttccacctgctccatgtggaaccagcagacattacg
cgtctgcaagatgcgctgggtgctattcgtgacggtgttactttctgccgcatttgctgc
aatatctctcgcgaagaggtctgccgcatttgtgcggactcttcacgcgaccgcagcacc
atctgtgtggtggaagaacccaaagacattcaggttattgaacgaaccggcgagtacaca
ggtcgctaccatgtgctcggcggctcgcttgacccccttgccaacattggcccccgtgag
ctcaacatttcgcaattattgcagcgtatcggcggcgtgttgccagaccgcgaacttgcg
gactccacccccgagacaccgctttacgacgcctccccagaagtgcgcgaggttatcctc
gccaccgaccccaacaccgaaggcgaagccacagcctcctacctagcgcggctgctgcgc
gacttcccagaccttgtggtgtcacgccttgcctctggcatgccactcggcggcgacttg
gagttcgttgacgaacttacactgtcgcgtgcgctgagcggcagactgacgctgtag

DBGET integrated database retrieval system