KEGG   Corynebacterium diphtheriae NCTC 13129: DIP0389Help
Entry
DIP0389           CDS       T00151                                 

Gene name
gpmA
Definition
(RefSeq) phosphoglyceromutase (EC:5.4.2.1)
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
cdi  Corynebacterium diphtheriae NCTC 13129
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:cdi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    DIP0389 (gpmA)
   01230 Biosynthesis of amino acids
    DIP0389 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DIP0389 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    DIP0389 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    DIP0389 (gpmA)
Enzymes [BR:cdi01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     DIP0389 (gpmA)
Exosome [BR:cdi04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   DIP0389 (gpmA)
  Exosomal proteins of melanoma cells
   DIP0389 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
Position
356496..357281
Genome map
AA seq 261 aa AA seqDB search
MLALLRFVANLTSMTTGKLILLRHGQSEWNASNQFTGWVDVNLTEKGEAEAKRGGELLKA
QGVLPSVVYTSLLRRAIRTANIALNAADRHWIPVVRDWRLNERHYGALQGLNKAETKEKY
GDEQFMAWRRSYGTPPPELEDSSEFSQANDPRYANLDVVPRTECLKDVVERFVPYFKEEI
LPRVKNGETVLIAAHGNSLRALVKHLDNISDADIAELNIPTGIPLVYELDEAGTVLNPGG
TYLDPEAAAAGAAAVAAQGAK
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
ttgctcgcgttgctgcgattcgtggcaaacttgacaagtatgactactggaaaactgatt
cttcttcgtcacggacaaagcgaatggaacgcttccaaccaattcaccggctgggtggac
gtcaacctcaccgaaaagggcgaggcagaggctaagcgcggcggcgagctgctcaaggct
cagggggtcctgccaagcgtggtgtacacctctttgctgcgccgtgctatccgcaccgcc
aacattgctctgaacgctgctgatcgccattggatcccagttgttcgcgattggcgcctc
aacgagcgccactacggtgcgctgcagggcctgaacaaggctgagactaaggaaaagtac
ggcgacgagcagttcatggcatggcgtcgttcttatggcaccccaccaccagagcttgag
gattccagcgagttctcccaggcaaacgatcctcgttacgccaaccttgacgtggttcct
cgcaccgagtgcttgaaggacgttgttgagcgtttcgttccttacttcaaggaagagatc
ctgccacgtgtgaagaacggtgagactgttttgatcgctgcacacggtaactccctgcgt
gcattggtcaagcacctagacaacatctctgatgcagacatcgctgagctcaacatccct
accggtattccactggtttatgagctcgacgaggctggcacggtgctcaacccaggtggc
acctaccttgacccagaagctgctgctgccggtgctgccgcagttgctgctcagggcgct
aagtag

DBGET integrated database retrieval system