KEGG   Corynebacterium diphtheriae NCTC 13129: DIP0403Help
Entry
DIP0403           CDS       T00151                                 

Gene name
hemB
Definition
delta-aminolevulinic acid dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
cdi  Corynebacterium diphtheriae NCTC 13129
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cdi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    DIP0403 (hemB)
Enzymes [BR:cdi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     DIP0403 (hemB)
Exosome [BR:cdi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   DIP0403 (hemB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
368725..369717
Genome map
AA seq 330 aa AA seqDB search
MNLDLIRRPRRLRSTPVMREFVAETTLRPADLILPMFIADGIDKPREIESMPGVYQHTME
SLIEAVREAISVGIRCVDLFGVPLDSDKDATGSQAWDPEGILNRGVRALRQEFGDQVLIM
ADTCLDEFTDHGHCGILTTDRFGATIVDNDPTVELYQKMAVAQAEAGAHIVSPSGMMDGQ
ILAIREALDAAGFHDVAIMAYSAKYASAFYGPFRDAVGSSLQGDRRAYQQDPANLRESIL
EVDLDIEEGADFVMVKPAMPYLDVLAEVASTSSVPVAAYQVSGEYAMLHAAAANGWLDLD
RVMMESLISIKRAGADQILTYFAVEAARKL
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgaatctagatcttattcgtcgtcctcgtcggttgcgttcgactccggtgatgcgtgaa
tttgttgcggaaaccacgctgcgtccggctgatcttattttgccgatgtttattgccgat
ggcattgataagcctcgggagattgagtcgatgccaggtgtgtaccagcacaccatggaa
tcccttatagaggctgtccgtgaggcgatctcggtgggtattcgttgcgtggatcttttt
ggtgtgccactggattccgataaggatgccactggttcacaagcgtgggatcccgagggc
attttgaaccgcggtgtgcgtgcgcttcgtcaggagttcggtgatcaggtgctcatcatg
gcggatacctgccttgacgagttcaccgatcatgggcactgtggcattttgaccacggat
cgctttggcgccaccattgtggataacgatccaacggttgagttgtatcagaagatggcg
gttgctcaggctgaagcgggtgctcatattgtgagcccgtcgggcatgatggacggccag
attttagctatccgtgaggctctcgacgccgcagggttccacgatgttgcgatcatggcg
tattccgctaaatatgcgtcggcgttttatggtcctttccgtgacgcagtgggctcctct
ttgcagggtgatcgtcgtgcctaccagcaggatcctgctaatctccgtgagtcgatcctc
gaagtcgatctggacatcgaggaaggcgcggattttgttatggtcaaacctgctatgccg
tacttggatgtgcttgctgaggtagcgtctacgtcgtcggttccggtggcggcttaccag
gtttctggcgagtatgcgatgttgcatgcggctgctgcgaacggctggttggatctggat
cgggtgatgatggagtctctgatttctattaaacgtgccggtgcggatcaaatcctgaca
tactttgctgtagaagcagcacgaaaactttaa

DBGET integrated database retrieval system