KEGG   Corynebacterium diphtheriae NCTC 13129: DIP0542Help
Entry
DIP0542           CDS       T00151                                 

Gene name
mapA
Definition
(GenBank) methionine aminopeptidase
  KO
K01265  
methionyl aminopeptidase [EC:3.4.11.18]
Organism
cdi  Corynebacterium diphtheriae NCTC 13129
Brite
Enzymes [BR:cdi01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.18  methionyl aminopeptidase
     DIP0542 (mapA)
Peptidases [BR:cdi01002]
 Metallo Peptidases
  Family M24
   DIP0542 (mapA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
511740..512534
Genome map
AA seq 264 aa AA seqDB search
MGFRSKRKVIPAKTPGELDAMQAAGEIVGEALQAVRAAAAVGVSTLELDAIAEQAIRDRG
AIPTFKGYGGFPGSICASVNDVIVHGIPNKETILKEGDLVSIDCGATLDGWVGDSAWTFG
IGTIADDVRALNEATEWVLYEGMKAMIPGNRLTDVSHALEMATRAAEKKFNVQLGIVDGY
GGHGIGHEMHEEPYLANEGKGGRGPMIQEGSVLAIEPMLTLGSVDSIVLADEWTVVTDDN
SWSSHWEHTVAATNDGPRILTPRK
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgggctttaggtctaagcgaaaagtaatcccagcaaaaacaccaggtgagctcgacgcc
atgcaggcggcaggtgaaatcgtcggcgaggcactccaagcggtgcgcgccgcggcagcc
gttggagtaagcacccttgagctcgacgctatcgccgagcaggccatccgtgatcgtgga
gcaatcccgaccttcaaaggctacggcggattcccaggctctatctgcgcctcggtcaac
gacgttatcgtgcacggaatccccaacaaagaaaccatcctcaaagagggcgacctggtt
tccatcgactgcggtgccaccttggatggttgggttggcgactccgcatggaccttcggc
atcggcaccattgccgacgatgtacgtgcgctgaatgaggccaccgagtgggttctctat
gaaggcatgaaggcaatgatccctggtaacaggcttaccgacgtctcccacgccttagag
atggctacccgcgcagcggaaaagaaattcaatgtacaactcggcattgttgacggctac
ggtggccacggaatcggtcacgaaatgcacgaagagccctaccttgctaacgaaggtaaa
ggcggccgcggcccaatgatccaagaaggatcggtactggccatcgagcccatgctgacc
cttggatccgtggattccatcgtgctcgccgacgaatggaccgtagttaccgacgataac
tcttggtcctcacactgggagcatacggttgcggcaaccaacgatggtcctaggattttg
actccgcgaaagtaa

DBGET integrated database retrieval system