KEGG   Corynebacterium diphtheriae NCTC 13129: DIP0546Help
Entry
DIP0546           CDS       T00151                                 

Gene name
rpsM
Definition
(GenBank) 30S ribosomal protein S13
  KO
K02952  
small subunit ribosomal protein S13
Organism
cdi  Corynebacterium diphtheriae NCTC 13129
Pathway
Ribosome
Module
Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:cdi00001]
 Genetic Information Processing
  Translation
   03010 Ribosome
    DIP0546 (rpsM)
Ribosome [BR:cdi03011]
 Ribosomal Proteins
  Bacteria
   Small subunit
    DIP0546 (rpsM)
  Archaea
    DIP0546 (rpsM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
516618..516986
Genome map
AA seq 122 aa AA seqDB search
MARLAGVDLPRNKRMEVALTYIYGIGPARAAQLLEETGISPDLRTDNLTDEQVSALRDVI
EATWKVEGDLRRQVQADIRRKIEIGCYQGLRHRRGLPVRGQRTKTNARTRKGPKKTIAGK
KK
NT seq 369 nt NT seq  +upstreamnt  +downstreamnt
atggcacgtctcgctggagttgaccttccgcgcaataagcgcatggaggttgcactcact
tacatttacggcatcggcccagcccgtgccgctcagctgctcgaggagaccggcatctcc
ccagatctgcgcaccgacaacctcaccgacgagcaggtttctgctcttcgtgacgttatc
gaagcaacttggaaggtagagggtgacctccgccgtcaggttcaagccgacatccgtcgc
aagattgaaatcggctgctaccagggcctacgccaccgtcgtggtctgccagtccgtggc
cagcgcaccaagaccaacgctcgtacgcgtaagggtcctaagaagacgatcgccggaaag
aagaagtaa

DBGET integrated database retrieval system