KEGG   Corynebacterium diphtheriae NCTC 13129: DIP0548Help
Entry
DIP0548           CDS       T00151                                 

Gene name
rpsD
Definition
(GenBank) 30S ribosomal protein S4
  KO
K02986  
small subunit ribosomal protein S4
Organism
cdi  Corynebacterium diphtheriae NCTC 13129
Pathway
Ribosome
Module
Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:cdi00001]
 Genetic Information Processing
  Translation
   03010 Ribosome
    DIP0548 (rpsD)
Ribosome [BR:cdi03011]
 Ribosomal Proteins
  Bacteria
   Small subunit
    DIP0548 (rpsD)
  Archaea
    DIP0548 (rpsD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
517418..518023
Genome map
AA seq 201 aa AA seqDB search
MARYTGPATRKSRRLRVDLVGGDMAFERRPYPPGQAGRARIKESEYLLQLQEKQKARFTY
GVLEKQFRRYYAEANRLPGKTGDNLVILLESRLDNVVYRAGLARTRRQARQLVSHGHFTV
NGKKINVPSYRVSQYDIIDVREKSQKMIWFEEAQENLLDAVVPAWLQVVPSTLRILVHQL
PERAQIDVPLQEQLIVELYSK
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atggctcgttataccggcccagcaacccgtaagtcccgccgcctccgcgtcgacctcgtc
ggcggagacatggcattcgagcgtcgcccataccctccaggacaggctggtcgtgctcgc
atcaaggagtccgagtacctcttgcagctccaggagaagcagaaggctcgtttcacctac
ggtgttctcgagaagcagttccgtcgttactacgcagaggctaaccgtctgccaggtaag
accggtgacaaccttgtcatcctgctcgagtcccgtctggacaacgtagtgtaccgtgca
ggtcttgcacgtacccgtcgtcaggctcgtcagcttgtttcccacggtcacttcaccgtg
aacggtaagaagatcaacgttccttcctaccgcgtctcccagtacgacatcatcgacgtt
cgcgagaagtcgcagaagatgatctggttcgaagaggctcaggagaacctgcttgacgct
gttgtacctgcatggttgcaggtcgttccgtccaccctgcgcatcctcgtgcaccagctg
cccgagcgcgctcagatcgacgttccgctgcaagagcagctcatcgtcgagctttactcg
aagtaa

DBGET integrated database retrieval system