KEGG   Corynebacterium diphtheriae NCTC 13129: DIP0550Help
Entry
DIP0550           CDS       T00151                                 

Gene name
rplQ
Definition
(GenBank) 50S ribosomal protein L17
  KO
K02879  
large subunit ribosomal protein L17
Organism
cdi  Corynebacterium diphtheriae NCTC 13129
Pathway
Ribosome
Module
Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:cdi00001]
 Genetic Information Processing
  Translation
   03010 Ribosome
    DIP0550 (rplQ)
Ribosome [BR:cdi03011]
 Ribosomal Proteins
  Mitochondria/ Chloroplast
   Large subunit
    DIP0550 (rplQ)
  Bacteria
    DIP0550 (rplQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
519202..519675
Genome map
AA seq 157 aa AA seqDB search
MPTPKKGARLGGSASHQKKILANLASQLIEHEAIKTTDAKAKLLRPYVEKLITKAKGGSV
ADRRNVAKFITNKEIVAKLFNELAPKFENREGGYTRIIKLENRKGDNAPMSQISLVLEET
VSAEATRAARAAASKKAEEPAEAVEAEAPAADEAEEK
NT seq 474 nt NT seq  +upstreamnt  +downstreamnt
atgcctacccctaagaagggcgcccgtctcggcggttccgcgagccaccagaagaagatt
ctggctaacctcgcttctcagctgatcgagcacgaggcaatcaagaccaccgacgccaag
gcaaagcttctgcgcccatacgtagaaaagctgatcaccaaggctaagggcggctccgtt
gcagatcgtcgcaacgttgctaagttcatcaccaacaaagagatcgtcgcaaagctcttc
aacgagctggctccaaagtttgaaaaccgtgagggtggctacacccgcatcatcaagctg
gagaaccgcaagggcgacaacgctccaatgagccagatctccctcgttctcgaggagact
gtctccgcagaagctacccgtgccgcacgcgctgctgcttccaagaaggctgaagagcct
gcagaagctgtagaagcagaagcaccagctgctgacgaggcagaagagaagtaa

DBGET integrated database retrieval system