KEGG   Corynebacterium diphtheriae NCTC 13129: DIP0552Help
Entry
DIP0552           CDS       T00151                                 

Definition
(GenBank) Conserved hypothetical protein
Organism
cdi  Corynebacterium diphtheriae NCTC 13129
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
520801..522099
Genome map
AA seq 432 aa AA seqDB search
MTNNQRPARGISPASKAQVSGYKFLQRRAELGLLLGDVRMLHDPIAKLRRGLLFGLSAAV
LLGVGSGALAVFSPAADPGDAPIMRSDSGDLFVRVDQQIHPVANLASARLVAGEPAQPVK
ASDSILAREHIGVPIGIPDAPRIVPEKSQEQPAWHVCHWDDAVEVTQVHDPHQRDFPAVA
DNTALVAATPFVEYLIVDSTRYLLPPADSPEGRSIRRRIGMTESTVRWRPPAEVISLIPE
GPPIALPAPESEILHSGKSSWLNINAHVVELSDLHLAILNDLGWRASHVPAAAINDLPDS
QEPLRLPERKYTFEEAALPPLCIGFIWQDDHDTQPRWDLKVFQRDKDAENLAVELSGDSP
ATHYAGTGMSQAVDTGSGWHVVSEHGQRHTLMTQENAHILGFKEFYRVPWEVVGLLPEGS
ALTAEAALAPLY
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
gtgacaaataatcaacgcccagcacgcggcattagtccagcaagcaaagcgcaagtttca
gggtacaaatttctccaacgacgcgccgagctaggccttttgcttggcgacgtccgcatg
ttgcacgatcccattgcaaaactacgaagaggcctactttttggcctcagtgctgcggtg
ttgttaggcgttggatcaggtgcgctagctgtgtttagccccgccgccgaccccggcgat
gcgccgatcatgcgcagcgacagcggtgatcttttcgtacgcgtagaccagcagattcac
cccgtagcaaatcttgcctccgcacgactggttgccggcgagcccgcacaaccagtaaaa
gcatccgattcaatattggcccgtgaacacattggggttcccatcggcatccccgacgcg
ccacgcattgttcccgagaaatcccaagaacaacccgcatggcatgtgtgccactgggac
gacgccgtggaagtaacacaagtacacgatccacatcagcgggactttcctgcagtagcg
gacaatactgcacttgtcgcggcgacaccgtttgtggaatacctcattgtggattcgaca
cgctacctgctgcctccggcggactcaccagaaggacgtagtattcgcaggcgcattggg
atgacagaatcaacagtgcggtggcgcccacccgcggaagtaatatcgctgataccagaa
gggccacccatagcacttccggccccagaatcagagattctgcatagcggtaaaagttca
tggctcaacatcaatgcccacgtggtggagctttctgacctacatttagccatcctcaat
gatctcgggtggcgcgctagccacgtaccagcagcggcgatcaacgacctacccgactcg
caggaaccactgcggcttcccgagcggaaatacacttttgaggaggcagcccttccacct
ctgtgcattggatttatatggcaagacgaccacgacacccaaccccgttgggatcttaag
gtgtttcaacgggataaagacgcagaaaaccttgcggtagagctttctggagattcaccg
gctacgcattatgcaggtacaggaatgtctcaagcggtagataccggtagcggatggcat
gttgtttctgagcacgggcaacgccatacactgatgacacaagaaaatgcccacatccta
gggtttaaggaattctaccgagtgccgtgggaagttgtgggattgcttcctgaaggcagc
gcattgacagccgaggcggcgctcgcgccactgtactag

DBGET integrated database retrieval system