KEGG   Corynebacterium diphtheriae NCTC 13129: DIP0554Help
Entry
DIP0554           CDS       T00151                                 

Definition
(GenBank) Putative subtilisin-like cell wall associated serine protease (mycosin)
Organism
cdi  Corynebacterium diphtheriae NCTC 13129
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(522858..523757)
Genome map
AA seq 299 aa AA seqDB search
MKTTGIIAIVLAVAWYCALPESVSAQQRCAVSAPLSDEQQSASDHWQVLPELHRIATGRG
VTVAVIDTGISPHPRLPRLIDGGSYLSGSYTPTGGLHDCDAHGTVVASIIAGQPGPDPVL
GVAPESQLISIQQTSNTAASGTVASLAHAIHTAIDQHAQIINISVVSCVASNHAVDDAVL
VEALRRAEESGTVVVSAAGNATGSTDDCVHGARVFPAHYPTVLTVGALKDPYHFADYSMP
SPFPLVSALGYVPAALAHDHPGISGGTLNHRSVYPFQGTSFAAPLCFRCCCIDKAAFPR
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgaagaccactggaattattgccattgtcctcgccgtagcgtggtattgtgcgttacct
gaatcagttagcgctcaacaacgctgtgccgtcagtgcgccgctatcggacgagcaacaa
tccgcatcagatcattggcaggttctgcctgaactgcatcgtattgctactggccgtggg
gtcactgttgcggttatcgatacaggtatttcaccgcatccacgcctaccgcggcttatc
gacggcggcagctacctaagcggcagttatacccccacgggaggtctgcacgattgtgat
gcccacggcacagttgtggcaagtattatcgctggtcaacctggacccgacccagtcctc
ggtgttgctccggaatcccagcttatttctattcagcaaaccagtaatactgcagcttca
ggcactgtggcttctttggctcatgcgatacataccgcgatcgatcagcatgctcagatc
attaatatttccgttgtctcctgtgttgctagcaatcatgccgttgatgatgctgtactc
gttgaggccctccggcgcgcagaagaatcgggcacggtggtggtatctgcagcgggcaat
gccaccggtagcacagatgattgtgttcatggtgctcgtgtttttccggcgcactacccc
actgtgttaacggtcggtgccttaaaggatccgtatcatttcgcggattactctatgccc
tcgccattcccattagttagtgcgttaggttatgttccagctgctctagctcacgaccat
cctggtatctccggaggcactctcaaccaccgcagcgtgtatccctttcaaggaaccagt
tttgcggcccccctatgtttcaggtgttgctgcattgataaagcagcgtttccccgctga

DBGET integrated database retrieval system