KEGG   Corynebacterium diphtheriae NCTC 13129: DIP0555Help
Entry
DIP0555           CDS       T00151                                 

Definition
(GenBank) Putative surface-anchored membrane protein
Organism
cdi  Corynebacterium diphtheriae NCTC 13129
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(523770..525185)
Genome map
AA seq 471 aa AA seqDB search
MQSMLHDVRLRFQIDASNGGHDSLAEVDISVPSQSTFSEIVPEVLGLAQQVSEQPLTDPE
VPVWQVISPAGLPYDMYAPVHTLQLSHGSSMIIRPHRPQAAPVIRDSAEALAHCSRSNAA
ARGTTECAAMAGALVIVLLGLRLPVESVPLSARWGAIAALLSIAFVITTRPLLLIPWLLA
TWSSVFFFLLGDSFTAVSHATSLSIVHTVLAAGTVALVVLAGIMVAARVSLWPIAHWLSG
IVTIVVCSFASAPAGWLHRDREFDVHGWFNGAASGVILCAVAVIVAGPSLALRVSAMPIP
RLPNTGQDLTVSDKVESPSDMMFKAQKASAIFQGMYVGSALSLAFAMAYLAVSPSVSGYC
VALCTFATVVCVFHAHRCPDAYSTWALWVAGMLGMIAATNGALDVFAWPWIVVSIFAAGS
TISAPVWVHKLSSVAPTTTQWLHRVESLAVAAIVPLAAHLMGIFSLLRGLG
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
gtgcaatccatgcttcacgacgtccgactgcggttccagatagacgcatccaatggcggt
cacgattcgctggctgaggtagatatttctgttccgtcgcagtcgacattctccgagata
gtccccgaagttttgggcttagctcaacaagtttccgaacagccactcactgatccggaa
gttcctgtgtggcaggtgatcagcccagctggcttaccttacgatatgtacgcgccagta
catacgcttcagttgtcgcacggcagtagcatgattattcgtccccatagaccgcaagcc
gccccggtaatccgcgattccgcagaggcacttgcgcattgtagtcgcagcaacgctgca
gcccgtggcaccaccgaatgtgctgcaatggctggtgcgctagtaatcgtgttgctgggg
cttcggctacccgtagaatcagtgccgttatcagcgcgctggggtgctatcgcagcacta
ctgagtatcgcttttgtgatcaccacgcgccctttgctcttgattccttggttgttggcc
acgtggtccagcgtgttcttctttttgctcggcgattctttcaccgctgtatcgcacgct
acgtcgctgagcattgttcatacggtgctagcagcgggaacagttgcgcttgtggtttta
gcaggaatcatggtggccgcgcgggtgtctctttggccgatagctcattggttaagcggc
attgttaccatcgtggtgtgttctttcgcgagtgcccctgctgggtggctgcatcgcgat
cgcgagtttgatgtgcacggttggtttaatggagccgcttctggtgtcattctttgtgcg
gtagcggtcattgttgctggcccgtcgcttgctttacgtgtttctgctatgcctatcccg
aggttgcctaataccggccaagatctcacggtcagcgacaaggtcgaatccccttcggac
atgatgtttaaggcgcaaaaagccagtgcgatttttcaaggaatgtatgtaggttctgct
ctctcattagcttttgcgatggcgtatcttgcggtcagtccctctgtttctggttattgc
gtagcactgtgcacatttgccacggttgtgtgtgttttccatgctcatcgttgtcctgat
gcttatagcacgtgggcgttgtgggtagctggaatgctcggtatgatcgccgcaactaat
ggtgctcttgatgtgtttgcgtggccgtggatcgtggtgagcatctttgccgcaggtagc
acgattagtgctccggtttgggtgcataagttaagcagtgttgcgcccactaccacccag
tggctccatcgtgtggaatcgttggcagttgctgcgattgttccactagctgcacacctc
atgggtattttctcattgcttcgtggattgggttag

DBGET integrated database retrieval system