KEGG   Corynebacterium diphtheriae NCTC 13129: DIP0556Help
Entry
DIP0556           CDS       T00151                                 

Definition
(GenBank) Putative FtsK/SpoIIIE family ATP-binding protein
  KO
K03466  
DNA segregation ATPase FtsK/SpoIIIE, S-DNA-T family
Organism
cdi  Corynebacterium diphtheriae NCTC 13129
Brite
Chromosome [BR:cdi03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Divisome proteins
    DIP0556
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
525441..528980
Genome map
AA seq 1179 aa AA seqDB search
MSLLRILMPVIMITVVIAMVGLMVISGGSLNPMMLIFPLMMGMSLLMMMSPTHGEDVNEM
RRVYLRHLIALRDTALHYGEQQRQHQCYRNPPPHHLVQWVETLRLWERQSQDSDALEVRI
GVGPTLLCTPIEMKNPGAPEDLDPVCAVSLRSTIRAVRTVHEVPISVQLQAFAFVMVTGD
RAHDLVRAIIAQLCFHHGPECVGITVATTGADQPKWWKWLPHTKDPQSARFEVLIVDFTV
AHPEQHDALITQILQSSATTVIILGEPDSDAPQRSDFMIIMRESGFQLDAGTKLVAVTES
GREVLGKSDTLSQVAAEHFARSLTGKIRPQHQVATTSDLRFLLGLGIPTPDTVSMRWEER
GAQRLTVPLGLTDAGTAMMLDIKESAHGGVGPHGLCVGATGSGKSELLRTLVVAMAATHS
PQSVNFVLVDFKGGATFLGLDALPHTSAVITNLEDEAVLVERMHDAISGEMNRRQELLRQ
AGNFINVGEFNQASSQGKIAHDPIPALFIVLDEFSELLGQHPDFADLFVAVGRLGRSLHI
HLLLASQRLEEGRLRGLDSHLSYRIGLKTFSAAESRQVLGIPDAYEIPNQPGTGFIKTGA
DTIVKFRASYVSGPMKQARGISATGSATVRPWNGWEDEHNDTESITNDAPSMPLPTLVDA
VVTAAQQRATELGLNAHKIWLPPLPNTLEISELPAATPGQLTAHVGLIDRPYRQRQDPLA
MNFEGHNGHAAICGGPQTGKTAALRTIVTALAAGNHTDTVRFYIADLSGQGLAQLQALPH
VAGIASRHESEKLGRMVDDILHLIDHPEQRHTFFIIDGWHIVAQEHEHLVESFNRIAADG
LAANIHLIITTPRWTTLRPAIRDLITQRLELKLGEALDSLIDRKAQSKLPTRPGVGLTPT
KEHMMLARSSNQDIAHVAQLCSNQPQVPQLKLLPTAVELHELASLSEKEHTTGIRLGIHG
RDLTTFTWDTKTSNHLLIFGSQGCGKSTTVATILAGICKRGPEAARCVVIDHRRAHLGTI
DPTMLAAYSASTTATEQTLASTVITLESRLPGPEITPEQLRQRSWWTGPDIFLVIDDADL
IPEPLWHRLVELIPHSRDIGLHIVAARKIGGSQRALYQSFYSAIKDQSPMVLVMDGERDD
GPLFGIRPQRLIPGRAIAVIRGSNQGQCHIAQNIPEIAS
NT seq 3540 nt NT seq  +upstreamnt  +downstreamnt
gtgtcgttgctgcgaatactgatgccagtcatcatgattaccgtggtcatcgccatggtt
gggctcatggtgatctctggtggatcccttaaccccatgatgttgattttcccgctgatg
atgggaatgtcgcttttgatgatgatgtcgccaacacatggtgaagacgtcaacgaaatg
cgtcgagtctacctgcgacatttgatcgccttacgtgataccgcgttgcactatggggag
cagcagcgacaacatcagtgctaccgcaacccgccaccgcatcatctcgtgcaatgggta
gaaaccctccggttatgggaacgccaatcacaagactccgacgcattagaagtacgtatt
ggcgtgggccccaccttgttgtgcacacctatcgagatgaaaaatcccggagcacctgag
gaccttgatccggtatgtgccgtgagtttgagatccacgattcgcgcggtgcgaactgta
cacgaggtgccaattagtgtgcagttgcaagcgtttgcctttgtgatggtgacaggggat
cgcgcacacgacttagtgcgagcaattatcgcccagttatgctttcaccacggccctgaa
tgcgtggggattacagttgccactactggtgcggatcagcctaaatggtggaagtggcta
ccacacaccaaagatccacagtcggcgcgattcgaagtgctcatagtagatttcaccgtg
gcgcatcctgagcaacacgatgcgttgatcacacagattctccagtccagcgctaccaca
gtgattattctgggcgaacctgactcggatgcgcctcagcgcagcgactttatgatcatc
atgcgggagtctggttttcaactagatgcaggtaccaaacttgtagcagtaacggagtcg
gggcgggaagtactcggcaagtcagatacgttgagtcaagtggctgcggagcattttgcc
cgaagtcttactgggaaaattcgaccgcagcaccaagtggctaccacctcagacctgaga
ttcttgttaggactgggaattcctaccccagatactgtttctatgcgttgggaggaacgc
ggcgcgcaacgactaacagttccgttagggctaaccgatgccggtaccgcgatgatgctc
gacatcaaggaatccgcccacggtggtgtggggccacatgggctatgtgtaggggcgaca
ggtagcggaaaatcagagctacttaggacacttgtggtcgcgatggcagcaacgcatagc
ccccaaagtgtgaatttcgtgttggtggatttcaaaggtggggccacgtttttggggctt
gatgcacttcctcatacatcggcggtgattactaacctcgaagacgaggcagtgttggtg
gaacgcatgcatgatgcgatttcaggagagatgaataggcgccaagagttgctgcgacag
gccggtaattttatcaatgtgggggagttcaatcaggctagttcgcaggggaagatagcg
cacgatccgattcctgcgctatttatcgtccttgatgagttttccgagttgctaggtcag
catccagattttgcggatctttttgttgccgtgggccgcctagggcgatcactgcatatt
cacttgttgcttgctagccaacgactagaagaaggccgattgcgtggcctcgattcgcac
ttaagttaccggatcggtttgaaaacattttccgcggcagaatctcggcaggtgttagga
attcccgatgcctacgaaatccctaatcagccaggtaccggatttattaaaactggagcc
gatacgattgtgaagtttcgcgcgtcatatgtttctggacccatgaaacaagcccgcggc
atcagcgccactgggagcgcgacagtgcgaccttggaacgggtgggaagacgaacacaac
gacacagaatctatcaccaacgatgcaccctcgatgccgttacccacgcttgtcgacgca
gtggtcaccgccgcccaacagcgagcaacagaacttggactcaatgcccataaaatctgg
cttccaccgcttcccaacacactcgaaatatctgaattaccagcggcaacgccgggacag
ttaactgcacatgtcggcttaattgatcgcccataccggcaacgccaagacccattagcg
atgaactttgaaggacataatgggcatgcagcaatatgcggtggacctcaaacaggaaaa
acagcagcattgcgcacgatcgttactgcactcgctgcgggaaaccacaccgataccgtg
aggttctatatagctgatctctcaggtcaaggcctagcacagcttcaagcattgccacac
gtagcagggattgcttcgcgtcacgaatccgaaaaacttgggcgcatggtggacgacatc
ctgcacctcatcgatcaccccgagcaacgccacacgtttttcattatcgatggctggcac
atcgttgcacaagaacacgagcacctagtggaatcgtttaatcgtattgctgcagatgga
ctagcagccaacatccatctgatcatcactactccacggtggactaccctgcgaccagcg
atcagggacctcatcacccaacgccttgaacttaaactcggcgaggccctcgattccctc
atcgatagaaaagcccaaagcaaactacccacacgtccaggcgttggattgacaccaacc
aaagaacacatgatgctggcacgcagcagcaaccaagacatcgcacatgtggcgcaacta
tgcagcaaccaaccacaagtaccgcagcttaaactcctgccgaccgctgtggaattacac
gaattagcgtcgttaagcgaaaaagaacacacaaccggaatacgactaggaattcacggg
cgcgatttaacaacctttacatgggatacaaaaaccagtaaccacctgcttattttcgga
tcacaaggctgcggcaaaagcacaaccgtggcaactattttggccggtatctgcaaacgc
ggccccgaagcagctcgatgcgtggtcattgaccatagacgagcacacctaggaaccatc
gaccccaccatgcttgccgcatactccgcgagcaccaccgcgaccgaacaaaccttggca
agcaccgtgatcactcttgaaagccgactcccaggacctgaaatcacacccgaacaactc
agacaacgctcatggtggaccggcccggacatctttcttgtcatcgacgatgcagactta
atcccagagccactatggcaccgactagtcgaactcatcccgcactcaagagacatagga
ctacatatcgttgccgctcgaaaaattggtggcagccagcgggcgctctaccagtcgttt
tactcggcaattaaagaccaatcacccatggtgctcgtcatggacggcgaacgtgacgat
gggccactattcggaatccggccacaacgcctcataccaggacgcgccatcgcagtgatc
cgtggcagcaaccaaggacaatgccatattgcacaaaacatcccagaaatagccagctag

DBGET integrated database retrieval system