KEGG   Corynebacterium diphtheriae NCTC 13129: DIP0558Help
Entry
DIP0558           CDS       T00151                                 

Definition
(GenBank) Conserved hypothetical CFP-10-like protein
Organism
cdi  Corynebacterium diphtheriae NCTC 13129
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
530237..530554
Genome map
AA seq 105 aa AA seqDB search
MSQGFKTEADVMRNTAHRVDDTNQEVSAELSRLRSIVDGVRASWEGTAQVSFDNLMQRWD
ASAKGLQDALQSISDNIRGNATSFENVEADNQSAFSAVGGQGLAL
NT seq 318 nt NT seq  +upstreamnt  +downstreamnt
atgtctcaaggttttaagaccgaagcagacgtcatgcgcaataccgctcaccgcgttgac
gacacaaaccaggaagtaagcgcggaactatctcgactgcgctccatcgtggatggagtt
cgcgcgtcttgggaaggcaccgcacaagtaagttttgacaacctgatgcagcgatgggat
gcctccgccaaggggcttcaagatgccctgcagtccatctcggacaacattcgtggcaac
gccacctcgtttgaaaacgtcgaagcagataaccaatccgcattctctgcagtaggcggt
caagggctcgcgctgtaa

DBGET integrated database retrieval system