KEGG   Corynebacterium diphtheriae NCTC 13129: DIP0565Help
Entry
DIP0565           CDS       T00151                                 

Definition
(GenBank) Hypothetical protein
Organism
cdi  Corynebacterium diphtheriae NCTC 13129
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
534197..535513
Genome map
AA seq 438 aa AA seqDB search
MTPDVAGYGRAVSDLRAASAGLYSGPAIAQEALAKAAGTTKGLRTDALRNTAQAMVGGSS
TAFVTDKFWGSLIKILAQIATSFIASGLLSLAERWLGGSDDADNIQVQSHQASDAIDCVD
QEATTNIATVISQLTTMIGQLVATLAGIDKKENPEAFAECVSAGAQAIDSAGKTIKQTCE
NRDKAIEQCFSTLTHRTEEKCSVQDPPPPPACTGGASGGAPVPAPATQPAGVVAPPPPPA
AGGRSSAGGGAADILGAVSSLISGLCEDSTTTEATTEVATQTTAETVEKTCEKANEKNTR
VATTTSVTETCLEEQESEVVVVDCKTETKSCEQTCIASGVIGAVGLGIAVLGIGALIHCI
TESMGAFDCVPPPPTPDVPPPPAPAPPPVIDNVPEPPPPPKQIPGMVPAAAPAPPPAPEP
PAPAPLSSHINVKKAGSW
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgacgcccgatgttgcaggatatgggcgggcagtatcggaccttcgcgctgcctcagcc
ggattgtattctgggcccgcaatcgcccaagaagctttagcaaaggcggcaggaacaacg
aaggggctgcgtacggatgccctgcgcaacaccgcacaggccatggtgggtggtagcagt
acggcgtttgtgaccgacaagttttggggctcgctcatcaagattttggcccaaattgcc
acgtcatttatcgctagtggtttgttgtcactggcggagcgctggcttggtggtagcgac
gatgccgataacattcaggtgcaatcccatcaagcatccgatgcgatcgattgcgtggac
caagaagctactaccaacatcgccacggtgattagtcagttgaccacgatgatcgggcag
ctagtagcaaccttggcgggcattgacaaaaaggaaaacccagaggcctttgccgaatgc
gttagcgccggtgcacaagccattgattccgcaggtaaaacgattaaacaaacatgcgaa
aaccgagacaaggccatcgaacagtgcttttcgacgctcactcaccgcaccgaagaaaaa
tgcagcgtccaagacccaccaccgccaccagcctgtaccggtggcgcttctggcggggca
cctgtgccagcacccgcaacccagcctgccggcgtagtagcaccaccaccgccacctgca
gccggaggccgtagcagtgccggcggtggggcagctgacatccttggtgcagtaagttca
ctgatcagtggcctatgcgaagacagcaccaccacagaagccacaacagaagtcgctacc
cagactacggctgaaaccgtcgagaaaacctgcgagaaagctaatgagaaaaacacacgt
gtggccaccaccacgagcgtgactgaaacctgccttgaggagcaagaatcagaagtagtg
gtggtcgattgtaaaacagagacaaagtcgtgtgaacagacatgtatagcatcaggtgtt
atcggtgcagtggggctaggtattgcagttcttggaataggggcacttatccactgcata
acagaatctatgggcgcattcgactgcgtgccaccaccaccaacccccgatgtacctcca
ccacctgctcctgcaccgccaccggtaatcgacaatgttccggagccaccgccaccacct
aagcagattccagggatggttccagcagccgcacctgcgccaccaccagcgcctgagcca
cctgctcctgcaccgttgtcatcgcacatcaatgtgaagaaagcggggtcatggtaa

DBGET integrated database retrieval system