KEGG   Corynebacterium diphtheriae NCTC 13129: DIP0566Help
Entry
DIP0566           CDS       T00151                                 

Definition
(GenBank) Hypothetical protein
Organism
cdi  Corynebacterium diphtheriae NCTC 13129
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
535507..535767
Genome map
AA seq 86 aa AA seqDB search
MVMAYSSDKAQQQINSYAEFVESFRQTTAKRMAEFEQELADAQKKAHEAAKKKRELPARA
SVAAEIGASIRPRSTRGKVRGVLRKV
NT seq 261 nt NT seq  +upstreamnt  +downstreamnt
atggtaatggcctattccagtgacaaagcgcagcaacagatcaactcctatgcggaattc
gtcgagtcttttagacaaacaacggcaaagcggatggctgagtttgaacaagaacttgcc
gatgcgcagaagaaagcacacgaagccgcaaagaagaaacgcgaactccccgcacgggca
tccgttgcggcagagataggggcgtcgatacgcccgcggagcacgcgtggaaaagtacgg
ggagtcctacggaaagtctga

DBGET integrated database retrieval system