KEGG   Corynebacterium diphtheriae NCTC 13129: DIP0568Help
Entry
DIP0568           CDS       T00151                                 

Gene name
alr
Definition
alanine racemase (EC:5.1.1.1)
Orthology
K01775  
alanine racemase [EC:5.1.1.1]
Organism
cdi  Corynebacterium diphtheriae NCTC 13129
Pathway
D-Alanine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cdi00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    DIP0568 (alr)
Enzymes [BR:cdi01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     DIP0568 (alr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
536812..537960
Genome map
AA seq 382 aa AA seqDB search
MNLLETRISCDAIAANTRRLKDMVAPAQLMCVVKADGYNHGAPEVATVMARNGADQFGVA
TLAEAHQLRDAGITLPILCWIWSPEQDFSAAIDRDIDLAAVSMDHVRALIAEAMRRPAGT
RVRVTVKIDTELHRSGIDEANWTEAFELLHACPQVNVTGVFSHLACADDLESDYTDHQAE
VFRRAISAGRNVGLDLPVNHLAASPATLTRPDLHFDMVRPGLALYGHEPIAGLDHGLREA
MTWIGSVTVVKPIAAGQGTSYNMTWHAPADGYLCVVPVGYADGLPRNVQGHLEVTIAGTR
YPQVGRVCMDQIVVFLGDNSRGVAPGDEAIIFGPRDTQAMTVTELACATGTINYEILCRP
TGRSHRTYSALDAVAPTHPTES
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgaacctgctcgaaactcgcatctcgtgcgacgccattgctgcgaacacgcgacgttta
aaagacatggttgctcccgctcagctcatgtgtgttgtaaaagctgacggctacaatcac
ggtgccccagaagttgctactgtgatggcgcgtaacggtgccgaccaatttggtgtcgca
acgcttgcggaagcacatcagctacgagacgcgggtatcactctccccatcctgtgctgg
atctggtcacccgagcaggacttttccgccgccattgaccgtgacatcgacttagccgcc
gtcagcatggatcacgttcgtgcactgatcgcagaggctatgcgtcgtcccgcaggtacc
cgagtgcgggtgaccgtgaaaattgacacggaacttcaccgatctggaattgacgaagca
aactggacagaagcctttgagcttcttcatgcttgcccccaagtcaacgtcacgggcgta
tttagtcacttggcatgcgcagacgacttggaatcggactacaccgaccaccaagcagag
gtatttcgcagggcgatttccgcaggtagaaacgtaggcctagaccttcctgttaatcat
ctagcggcatcgccagcaacactaacccgccccgacttgcactttgacatggtccgacct
gggcttgccctctatggtcacgaaccgatagcagggctcgaccatgggctgcgcgaagcc
atgacatggattggttcagtaacagtggtcaaacccatcgcggcaggccaaggaaccagc
tacaacatgacatggcatgcgcccgcagatggctacctctgcgtggtgccggtgggctat
gcggacggattaccgcgcaacgtacaaggacatttagaagtaacgatcgccggcacgcgc
tacccacaagtagggcgcgtttgtatggaccagattgtggtattccttggcgataattcc
cgcggtgttgcccctggtgatgaggcaattatttttggtccaagagatacccaagcgatg
accgtcacggagctggcctgcgctacgggaaccatcaactatgaaatcttgtgccgcccg
accggacgaagccatagaacctatagtgctcttgacgccgttgcgcccacgcaccctact
gaaagctga

DBGET integrated database retrieval system