KEGG   Corynebacterium diphtheriae NCTC 13129: DIP0569Help
Entry
DIP0569           CDS       T00151                                 

Definition
(GenBank) Conserved hypothetical protein
  KO
K06925  
tRNA threonylcarbamoyladenosine biosynthesis protein TsaE
Organism
cdi  Corynebacterium diphtheriae NCTC 13129
Brite
Transfer RNA biogenesis [BR:cdi03016]
 Prokaryotic Type
  tRNA modification factors
   Other tRNA modification factors
    DIP0569
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
537967..538461
Genome map
AA seq 164 aa AA seqDB search
MDTTFARSGNIRLETAAETQAFAEELGRHLEAGDVIILDGPLGAGKTTFTQGLARGLNVK
GRVTSPTFVIAREHKSLSGGPSLVHVDAYRLIDDAAGATDPIGALDSLDLETELEDAVVV
AEWGGGLVEQITDSYLLITFDRTTAHIDDPDSEARIVTWKVIEP
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atggataccacctttgctcgtagcggaaacatacgactcgaaaccgccgcagaaacccaa
gccttcgccgaagaacttggtcgtcatctcgaagcaggagacgtaatcattctcgacggc
cccctcggcgcaggtaaaaccaccttcacccaagggttagcccgcggactcaacgtcaaa
ggccgcgttacctcgccaaccttcgtgatcgctcgcgaacacaagtcactaagcggtgga
ccatcgcttgtacacgtcgacgcataccgccttatcgacgacgccgccggtgccaccgat
cccatcggtgcactcgattctctagacctagaaactgagctagaagatgccgttgtagtc
gccgaatggggtgggggactagtcgaacagattactgatagctacctgctcatcaccttt
gatcggaccacagcgcatatcgacgaccccgattcggaggccagaattgtgacgtggaaa
gttatcgaaccctaa

DBGET integrated database retrieval system