KEGG   Corynebacterium diphtheriae NCTC 13129: DIP0570Help
Entry
DIP0570           CDS       T00151                                 

Definition
(GenBank) Putative membrane protein
  KO
K07085  
putative transport protein
Organism
cdi  Corynebacterium diphtheriae NCTC 13129
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
538648..540333
Genome map
AA seq 561 aa AA seqDB search
MQIRVPQRNRGRTFPHRSSHRRTPIHILEFLAAQPLLTLALILAVGLLIGKIRFFGISLG
AAAVLFVALALSTVDPALQLPPLVYQLGLAMFVYAIGLSAGSEFFAEFRHRGWKLTLFMI
GLLMLMMAVAYGIIKLFGLDEIIGAGMFAGALSSTPGMAAMVEMLEGIDDSVASEPVVGY
SLAYPGAVIGSILVAAIGAKLMKVNHAADAAEEGLVSDPLEWTGVRIGPGINGTIAQLPT
LAGEEIIATRVVHSKTFHSLAAPNDRLHEGMVLVIHGTPDALERAIAKVGKQQDVPIEDT
DLVYSRFTVSSKAVVGRKISDLDTVRSGFIISRLRRGDADVVPEPDDVLHYSDRVRVIAP
ANRMSEVRRFLGDSERSLADVDLMPFAFGLVIGLAIGVIPIPLPGGNTLSLGFGGGPIVA
GLILGALNRTGPIHWQMPYHASRTISTFGLAIFLAGVGTSAGVGFRQALTDPASLTVIAG
GFIVTISSALVCALVCMPLFKLKWDEAMGVAAGCTTNPAIISYLNGQTGTELATRGYATV
YPTAMIGKIIASQMLLLALIA
NT seq 1686 nt NT seq  +upstreamnt  +downstreamnt
gtgcagatacgtgtccctcaacgcaacaggggccggacgtttcctcatcgttcgtctcac
aggagaactccaattcatatcctcgaatttctcgcagctcagcccctgctgacgctcgcg
ctcattctggccgtcggcctgcttatcggcaagatccgattcttcggaatctcactcggt
gccgccgccgtcctcttcgtagccctcgcgctatccacagtggacccagccctccaactg
ccaccactggtctatcagcttggcctcgccatgttcgtgtacgccatcggtctgtctgcc
ggctccgaattcttcgctgaattccgccaccgcggttggaaactcaccctgttcatgatc
ggcctgctcatgcttatgatggccgttgcatacggcatcatcaagctatttggcctcgac
gaaatcatcggtgccggcatgttcgccggtgcactctcatcaacccccggcatggccgcc
atggtcgaaatgctggaaggaatcgacgattctgtcgcatcagaaccagtcgtggggtac
tcgctggcatacccaggtgctgtgatcggatcgattcttgttgcagccattggtgcgaag
ttgatgaaggtcaaccatgccgccgacgctgccgaagaaggcttggtgtcggatccgctg
gagtggaccggtgtgcgcatcggcccaggaatcaacggtacgatcgcccagctgccaact
cttgccggtgaggaaatcatcgctactcgcgtggtgcactccaagactttccactctctt
gctgcgccgaatgatcgtctgcacgaaggcatggtgttggtgattcatggcacccctgat
gcgcttgagcgtgctatcgctaaggtcggtaagcagcaggatgtaccgattgaagatacc
gatttggtttattcacggttcacggtgtcgtcgaaagctgttgtcggccgcaagatttcg
gacctcgacacggttcgttccggcttcattatttcccgcctgcgtcgtggcgacgccgat
gttgtgcccgagcctgacgacgtgctgcactactctgaccgtgtgcgcgtgatcgccccc
gctaaccgcatgagcgaagtgcgtcgcttcctcggcgactctgaacgctcgcttgccgac
gtcgacctcatgccattcgccttcggccttgtcatcggtctagctattggtgttatcccg
atcccgctgccaggcggaaacaccttgtctttgggcttcggtggtggccccatcgtcgca
ggcctgatcctcggcgcgctcaaccgcaccggcccgatccactggcagatgccttatcac
gcaagccgcacgatcagcaccttcggtctggccatcttcctcgccggcgtgggaacatcc
gctggcgtgggcttccgccaagcgctcacggaccctgcctcgctcaccgtcatcgccggt
ggcttcatcgtgactatctcttccgcactcgtgtgtgctttggtctgcatgccgctattc
aaactgaaatgggacgaagcaatgggcgtggcagcaggatgtaccaccaaccccgccatc
atctcctacctcaacggacaaaccggcactgagctggccacacgtgggtacgccaccgtg
tatcccacggccatgatcggcaaaattattgccagccagatgctactgttggcactgatc
gcttaa

DBGET integrated database retrieval system